BLASTX nr result
ID: Cheilocostus21_contig00056861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00056861 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021688125.1| lysine histidine transporter 1-like [Hevea b... 59 2e-08 gb|PKA55496.1| Lysine histidine transporter 2 [Apostasia shenzhe... 62 3e-08 ref|XP_009411834.1| PREDICTED: lysine histidine transporter 1 [M... 61 9e-08 gb|PLY88158.1| hypothetical protein LSAT_5X102160 [Lactuca sativa] 57 1e-07 ref|XP_002870677.1| lysine histidine transporter 1 isoform X1 [A... 60 1e-07 gb|AAC49885.1| lysine and histidine specific transporter [Arabid... 60 2e-07 ref|NP_851109.1| lysine histidine transporter 1 [Arabidopsis tha... 60 2e-07 gb|KOM38186.1| hypothetical protein LR48_Vigan03g156800 [Vigna a... 60 2e-07 gb|ONK71142.1| uncharacterized protein A4U43_C04F5140 [Asparagus... 59 2e-07 gb|PHU27898.1| Lysine histidine transporter 1 [Capsicum chinense] 55 2e-07 gb|OIW09423.1| hypothetical protein TanjilG_14574 [Lupinus angus... 60 2e-07 dbj|BAT84602.1| hypothetical protein VIGAN_04202000 [Vigna angul... 60 2e-07 gb|ESQ28527.1| hypothetical protein EUTSA_v100187781mg, partial ... 55 3e-07 gb|OAY63915.1| Lysine histidine transporter 2, partial [Ananas c... 59 3e-07 gb|PNY12080.1| lysine/histidine transporter 1-like protein, part... 55 3e-07 ref|XP_020111375.1| lysine histidine transporter 2-like [Ananas ... 59 3e-07 ref|XP_011045191.1| PREDICTED: lysine histidine transporter 1 [P... 59 3e-07 ref|XP_015971387.1| lysine histidine transporter 1-like [Arachis... 59 3e-07 gb|KVI02538.1| Amino acid transporter, transmembrane [Cynara car... 59 3e-07 gb|PLY75944.1| hypothetical protein LSAT_4X77821 [Lactuca sativa] 59 4e-07 >ref|XP_021688125.1| lysine histidine transporter 1-like [Hevea brasiliensis] Length = 96 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/37 (67%), Positives = 29/37 (78%), Gaps = 5/37 (13%) Frame = +3 Query: 387 ADDHQQDS-----KKTLDDWLPITSSRNAKWWYSAFH 482 ADD QD+ +K +DDWLP+TSSRNAKWWYSAFH Sbjct: 2 ADDQPQDTSLAVRRKAIDDWLPVTSSRNAKWWYSAFH 38 >gb|PKA55496.1| Lysine histidine transporter 2 [Apostasia shenzhenica] Length = 443 Score = 62.4 bits (150), Expect = 3e-08 Identities = 27/33 (81%), Positives = 27/33 (81%) Frame = +3 Query: 384 EADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 EA D KKTLDDWLPITSSRNAKWWYSAFH Sbjct: 6 EATAATSDGKKTLDDWLPITSSRNAKWWYSAFH 38 >ref|XP_009411834.1| PREDICTED: lysine histidine transporter 1 [Musa acuminata subsp. malaccensis] Length = 440 Score = 60.8 bits (146), Expect = 9e-08 Identities = 23/38 (60%), Positives = 31/38 (81%) Frame = +3 Query: 369 VDTMAEADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 ++ + ++D++ D K +DDWLPITSSRNAKWWYSAFH Sbjct: 1 MNNQSSSNDNKTDKDKAIDDWLPITSSRNAKWWYSAFH 38 >gb|PLY88158.1| hypothetical protein LSAT_5X102160 [Lactuca sativa] Length = 78 Score = 56.6 bits (135), Expect = 1e-07 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +3 Query: 390 DDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 +D + +K +DDWLP+TSSRNAKWWYSAFH Sbjct: 9 NDRRTTEEKAIDDWLPVTSSRNAKWWYSAFH 39 >ref|XP_002870677.1| lysine histidine transporter 1 isoform X1 [Arabidopsis lyrata subsp. lyrata] gb|EFH46936.1| hypothetical protein ARALYDRAFT_916150 [Arabidopsis lyrata subsp. lyrata] Length = 445 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 5/39 (12%) Frame = +3 Query: 381 AEADDHQQDSK-----KTLDDWLPITSSRNAKWWYSAFH 482 A DDHQ D K K +D+WLPITSSRNAKWWYSAFH Sbjct: 5 APHDDHQDDEKLAARQKEIDEWLPITSSRNAKWWYSAFH 43 >gb|AAC49885.1| lysine and histidine specific transporter [Arabidopsis thaliana] Length = 446 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 6/40 (15%) Frame = +3 Query: 381 AEADDHQQDSK------KTLDDWLPITSSRNAKWWYSAFH 482 A DDHQ D K K ++DWLPITSSRNAKWWYSAFH Sbjct: 5 APHDDHQDDEKLAAARQKEIEDWLPITSSRNAKWWYSAFH 44 >ref|NP_851109.1| lysine histidine transporter 1 [Arabidopsis thaliana] sp|Q9FKS8.1|LHT1_ARATH RecName: Full=Lysine histidine transporter 1 gb|AAK56270.1|AF367281_1 AT5g40780/K1B16_3 [Arabidopsis thaliana] dbj|BAB11340.1| amino acid permease [Arabidopsis thaliana] gb|AAM91380.1| At5g40780/K1B16_3 [Arabidopsis thaliana] gb|AED94593.1| lysine histidine transporter 1 [Arabidopsis thaliana] gb|OAO91955.1| LHT1 [Arabidopsis thaliana] Length = 446 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/40 (67%), Positives = 29/40 (72%), Gaps = 6/40 (15%) Frame = +3 Query: 381 AEADDHQQDSK------KTLDDWLPITSSRNAKWWYSAFH 482 A DDHQ D K K ++DWLPITSSRNAKWWYSAFH Sbjct: 5 APHDDHQDDEKLAAARQKEIEDWLPITSSRNAKWWYSAFH 44 >gb|KOM38186.1| hypothetical protein LR48_Vigan03g156800 [Vigna angularis] Length = 327 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +3 Query: 351 PLSSWFVDTMAEADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 P + F + E D+ + +K +DDWLPITSSRNAKWWYSAFH Sbjct: 6 PTTQKFHSSELEIDNKRTAEQKAIDDWLPITSSRNAKWWYSAFH 49 >gb|ONK71142.1| uncharacterized protein A4U43_C04F5140 [Asparagus officinalis] Length = 228 Score = 58.9 bits (141), Expect = 2e-07 Identities = 24/37 (64%), Positives = 26/37 (70%) Frame = +3 Query: 372 DTMAEADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 D + H D KK +DWLPITSSRNAKWWYSAFH Sbjct: 9 DNYVANNQHSLDEKKKAEDWLPITSSRNAKWWYSAFH 45 >gb|PHU27898.1| Lysine histidine transporter 1 [Capsicum chinense] Length = 67 Score = 55.5 bits (132), Expect = 2e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 393 DHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 D + + +K +D+WLPITSSRNAKWWYSAFH Sbjct: 5 DGRSEEQKRIDEWLPITSSRNAKWWYSAFH 34 >gb|OIW09423.1| hypothetical protein TanjilG_14574 [Lupinus angustifolius] Length = 431 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 384 EADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 E DD + +K +DDWLPITSSRNAKWWYSAFH Sbjct: 20 EKDDKRTAEQKAIDDWLPITSSRNAKWWYSAFH 52 >dbj|BAT84602.1| hypothetical protein VIGAN_04202000 [Vigna angularis var. angularis] Length = 455 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/44 (56%), Positives = 31/44 (70%) Frame = +3 Query: 351 PLSSWFVDTMAEADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 P + F + E D+ + +K +DDWLPITSSRNAKWWYSAFH Sbjct: 6 PTTQKFHSSELEIDNKRTAEQKAIDDWLPITSSRNAKWWYSAFH 49 >gb|ESQ28527.1| hypothetical protein EUTSA_v100187781mg, partial [Eutrema salsugineum] Length = 48 Score = 54.7 bits (130), Expect = 3e-07 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = +3 Query: 378 MAEADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 ++ + + +K +DDWLPITSSRNAKWWYSAFH Sbjct: 6 LSSSSEAASTRQKNVDDWLPITSSRNAKWWYSAFH 40 >gb|OAY63915.1| Lysine histidine transporter 2, partial [Ananas comosus] Length = 365 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +3 Query: 399 QQDSKKTLDDWLPITSSRNAKWWYSAFH 482 QQ++ K++DDWLPITSSRNAKWWYSAFH Sbjct: 17 QQENTKSIDDWLPITSSRNAKWWYSAFH 44 >gb|PNY12080.1| lysine/histidine transporter 1-like protein, partial [Trifolium pratense] Length = 81 Score = 55.5 bits (132), Expect = 3e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +3 Query: 393 DHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 D++ +K +DDWLPITSSRNAKWWY+AFH Sbjct: 31 DNRTAEQKAIDDWLPITSSRNAKWWYAAFH 60 >ref|XP_020111375.1| lysine histidine transporter 2-like [Ananas comosus] Length = 446 Score = 59.3 bits (142), Expect = 3e-07 Identities = 23/28 (82%), Positives = 27/28 (96%) Frame = +3 Query: 399 QQDSKKTLDDWLPITSSRNAKWWYSAFH 482 QQ++ K++DDWLPITSSRNAKWWYSAFH Sbjct: 17 QQENTKSIDDWLPITSSRNAKWWYSAFH 44 >ref|XP_011045191.1| PREDICTED: lysine histidine transporter 1 [Populus euphratica] Length = 449 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +3 Query: 390 DDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 DD Q +K +DDWLPITSSRNAKWWYSAFH Sbjct: 17 DDEQVARQKAIDDWLPITSSRNAKWWYSAFH 47 >ref|XP_015971387.1| lysine histidine transporter 1-like [Arachis duranensis] Length = 451 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 405 DSKKTLDDWLPITSSRNAKWWYSAFH 482 D +KTLDDWLPITSSRNAKWWYSAFH Sbjct: 23 DMQKTLDDWLPITSSRNAKWWYSAFH 48 >gb|KVI02538.1| Amino acid transporter, transmembrane [Cynara cardunculus var. scolymus] Length = 735 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +3 Query: 378 MAEADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 M D D KK +D+WLPITSSRNAKWWYSAFH Sbjct: 1 MGTQDQQYGDDKKAIDEWLPITSSRNAKWWYSAFH 35 >gb|PLY75944.1| hypothetical protein LSAT_4X77821 [Lactuca sativa] Length = 394 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 378 MAEADDHQQDSKKTLDDWLPITSSRNAKWWYSAFH 482 MA A D +K+L+DWLPITSSRNAKWWYSAFH Sbjct: 1 MATATTKTTDDEKSLNDWLPITSSRNAKWWYSAFH 35