BLASTX nr result
ID: Cheilocostus21_contig00056772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00056772 (827 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384348.1| PREDICTED: chitin elicitor receptor kinase 1... 58 9e-06 >ref|XP_009384348.1| PREDICTED: chitin elicitor receptor kinase 1-like [Musa acuminata subsp. malaccensis] Length = 606 Score = 57.8 bits (138), Expect = 9e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 3 FGLAKLTDVGASLQTRLVGTFGYMPPE*DAYKALS 107 FGLAKLT+VGASLQTRLVGTFGYMPPE Y +S Sbjct: 447 FGLAKLTEVGASLQTRLVGTFGYMPPEYAQYGEIS 481