BLASTX nr result
ID: Cheilocostus21_contig00056729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00056729 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIT40166.1| hypothetical protein A4A49_53752, partial [Nicoti... 57 7e-08 gb|OIT07293.1| hypothetical protein A4A49_53366 [Nicotiana atten... 58 1e-07 gb|ERN03665.1| hypothetical protein AMTR_s00144p00067060 [Ambore... 57 1e-07 gb|OIS98103.1| hypothetical protein A4A49_62402, partial [Nicoti... 57 3e-07 gb|OIT28827.1| hypothetical protein A4A49_53865 [Nicotiana atten... 56 6e-07 >gb|OIT40166.1| hypothetical protein A4A49_53752, partial [Nicotiana attenuata] Length = 121 Score = 57.4 bits (137), Expect = 7e-08 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -2 Query: 406 RTEFLIQWVGQPEVEPSWERAAMLWQFEPQI*DYLAL*SLTAATPSGRGG 257 RTEFLIQW G+ E + +WE+ LWQF+ Q+ DYL S A++ +G GG Sbjct: 64 RTEFLIQWKGRQEADATWEKTKSLWQFDKQLEDYLKTASTRASSSTGGGG 113 >gb|OIT07293.1| hypothetical protein A4A49_53366 [Nicotiana attenuata] gb|OIT18925.1| hypothetical protein A4A49_66143 [Nicotiana attenuata] Length = 174 Score = 57.8 bits (138), Expect = 1e-07 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -2 Query: 406 RTEFLIQWVGQPEVEPSWERAAMLWQFEPQI*DYLAL*SLTAATPSGRGG 257 +T+FLIQW G+PE + +WE+ A LWQ+E QI DYL S A++ + GG Sbjct: 117 QTQFLIQWKGKPEADTTWEKGASLWQYEQQIEDYLKSASTRASSSTSGGG 166 >gb|ERN03665.1| hypothetical protein AMTR_s00144p00067060 [Amborella trichopoda] Length = 142 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -2 Query: 400 EFLIQWVGQPEVEPSWERAAMLWQFEPQI*DYLAL*SLTAATPSGRGG 257 E L++W G PE E WER A LWQFE QI +YL S A+TPSG GG Sbjct: 88 EDLVKWKGLPESEAIWERDATLWQFEKQINEYLCEKSTRASTPSGWGG 135 >gb|OIS98103.1| hypothetical protein A4A49_62402, partial [Nicotiana attenuata] Length = 196 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -2 Query: 406 RTEFLIQWVGQPEVEPSWERAAMLWQFEPQI*DYLAL*SLTAATPSGRGG 257 RTEFLIQW G+ E + +WE+ LWQF+ Q+ DYL S A++ +G GG Sbjct: 139 RTEFLIQWKGRQEADATWEKTKSLWQFDKQLEDYLKTASTRASSSTGGGG 188 >gb|OIT28827.1| hypothetical protein A4A49_53865 [Nicotiana attenuata] Length = 183 Score = 56.2 bits (134), Expect = 6e-07 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -2 Query: 406 RTEFLIQWVGQPEVEPSWERAAMLWQFEPQI*DYLAL*SLTAATPSGRGG 257 RT+FLIQW G+PE + +WE+ A LWQ+E QI YL S A++ + GG Sbjct: 126 RTKFLIQWKGKPEADATWEKGASLWQYEQQIEKYLKSASTRASSSTSGGG 175