BLASTX nr result
ID: Cheilocostus21_contig00056396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00056396 (1607 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI33798.3| unnamed protein product, partial [Vitis vinifera] 75 4e-12 ref|XP_009399429.1| PREDICTED: 26S proteasome non-ATPase regulat... 79 5e-12 gb|KMZ70309.1| 26S proteasome regulatory subunit N9 [Zostera mar... 79 6e-12 ref|XP_010920026.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteaso... 79 6e-12 ref|XP_020260652.1| 26S proteasome non-ATPase regulatory subunit... 77 1e-11 ref|XP_020084854.1| 26S proteasome non-ATPase regulatory subunit... 77 2e-11 ref|XP_020247786.1| 26S proteasome non-ATPase regulatory subunit... 77 2e-11 gb|OEL16228.1| 26S proteasome non-ATPase regulatory subunit 13-l... 77 3e-11 gb|ONM00353.1| 26S proteasome non-ATPase regulatory subunit 13 h... 75 3e-11 dbj|BAB78503.1| 26S proteasome regulatory particle non-ATPase su... 75 3e-11 gb|AIZ68141.1| 26S proteasome non-ATPase regulatory subunit 13 B... 76 4e-11 gb|KJB25209.1| hypothetical protein B456_004G181400 [Gossypium r... 75 4e-11 gb|KJB25208.1| hypothetical protein B456_004G181400 [Gossypium r... 75 4e-11 gb|ONM00355.1| 26S proteasome non-ATPase regulatory subunit 13 h... 75 5e-11 dbj|BAS82957.1| Os03g0214600, partial [Oryza sativa Japonica Group] 75 5e-11 ref|XP_020570806.1| 26S proteasome non-ATPase regulatory subunit... 72 5e-11 ref|XP_006644222.1| PREDICTED: 26S proteasome non-ATPase regulat... 75 6e-11 ref|XP_014521188.1| 26S proteasome non-ATPase regulatory subunit... 75 6e-11 ref|XP_002275168.1| PREDICTED: 26S proteasome non-ATPase regulat... 75 6e-11 gb|PPD83733.1| hypothetical protein GOBAR_DD19312 [Gossypium bar... 75 6e-11 >emb|CBI33798.3| unnamed protein product, partial [Vitis vinifera] Length = 181 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 I SL+GTKVEWLY+ILQAFNSG+LVRYQELCR+HN ALSA Sbjct: 22 IKSLLGTKVEWLYYILQAFNSGDLVRYQELCRVHNAALSA 61 >ref|XP_009399429.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Musa acuminata subsp. malaccensis] Length = 387 Score = 79.0 bits (193), Expect = 5e-12 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 IN LIGTKVEWLYHILQAFNSGNLVRYQELCRIHN LSA Sbjct: 228 INILIGTKVEWLYHILQAFNSGNLVRYQELCRIHNAELSA 267 >gb|KMZ70309.1| 26S proteasome regulatory subunit N9 [Zostera marina] Length = 387 Score = 78.6 bits (192), Expect = 6e-12 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSLI TKVEWLYHILQAFN+GNLVRY ELCR+HNTALSA Sbjct: 228 INSLIKTKVEWLYHILQAFNTGNLVRYHELCRVHNTALSA 267 >ref|XP_010920026.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Elaeis guineensis] Length = 387 Score = 78.6 bits (192), Expect = 6e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSL+GTKVEWLYHILQAFN+GNL+RYQELC +HN ALSA Sbjct: 228 INSLLGTKVEWLYHILQAFNTGNLIRYQELCHVHNAALSA 267 >ref|XP_020260652.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B [Asparagus officinalis] gb|ONK71555.1| uncharacterized protein A4U43_C04F9840 [Asparagus officinalis] Length = 387 Score = 77.4 bits (189), Expect = 1e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSL+GTKVEWLY+ILQAFN+GNL+RYQELCR+HN ALSA Sbjct: 228 INSLLGTKVEWLYYILQAFNTGNLLRYQELCRVHNAALSA 267 >ref|XP_020084854.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Ananas comosus] gb|OAY77550.1| 26S proteasome non-ATPase regulatory subunit B [Ananas comosus] Length = 386 Score = 77.0 bits (188), Expect = 2e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSL+GT VEW+YHILQAFN+GNLVRYQELCR+HN ALSA Sbjct: 227 INSLLGTGVEWVYHILQAFNTGNLVRYQELCRVHNAALSA 266 >ref|XP_020247786.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Asparagus officinalis] Length = 387 Score = 77.0 bits (188), Expect = 2e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSLIGTKVEWLY+ILQAFN+G+L+RYQELCR+HN ALSA Sbjct: 228 INSLIGTKVEWLYYILQAFNTGDLIRYQELCRVHNAALSA 267 >gb|OEL16228.1| 26S proteasome non-ATPase regulatory subunit 13-like protein B [Dichanthelium oligosanthes] Length = 429 Score = 77.0 bits (188), Expect = 3e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 1485 QINSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 QINSLIGTKVEW+YH+LQAFN+GNL YQELCR+HN ALSA Sbjct: 269 QINSLIGTKVEWVYHMLQAFNTGNLALYQELCRVHNAALSA 309 >gb|ONM00353.1| 26S proteasome non-ATPase regulatory subunit 13 homolog A [Zea mays] Length = 267 Score = 75.1 bits (183), Expect = 3e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSLIGTKVEW+YH+LQAFNSGNL YQELCR+HN AL+A Sbjct: 108 INSLIGTKVEWVYHMLQAFNSGNLALYQELCRVHNAALTA 147 >dbj|BAB78503.1| 26S proteasome regulatory particle non-ATPase subunit9b, partial [Oryza sativa Japonica Group] Length = 281 Score = 75.1 bits (183), Expect = 3e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSLIGTKVEW+YH+LQAFN+GNL YQELCR+HN ALSA Sbjct: 122 INSLIGTKVEWVYHMLQAFNTGNLALYQELCRVHNAALSA 161 >gb|AIZ68141.1| 26S proteasome non-ATPase regulatory subunit 13 B-like protein [Ornithogalum saundersiae] Length = 387 Score = 76.3 bits (186), Expect = 4e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSL+GTK+EWLYHI+QAFN+GNLVRYQELC +HN ALSA Sbjct: 228 INSLLGTKLEWLYHIIQAFNTGNLVRYQELCLVHNAALSA 267 >gb|KJB25209.1| hypothetical protein B456_004G181400 [Gossypium raimondii] Length = 294 Score = 75.1 bits (183), Expect = 4e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 I SL+GTKVEWLY+ILQ+FNSGNLVRY+ELCR+HN ALSA Sbjct: 227 IKSLLGTKVEWLYYILQSFNSGNLVRYEELCRVHNAALSA 266 >gb|KJB25208.1| hypothetical protein B456_004G181400 [Gossypium raimondii] gb|KJB25210.1| hypothetical protein B456_004G181400 [Gossypium raimondii] Length = 296 Score = 75.1 bits (183), Expect = 4e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 I SL+GTKVEWLY+ILQ+FNSGNLVRY+ELCR+HN ALSA Sbjct: 227 IKSLLGTKVEWLYYILQSFNSGNLVRYEELCRVHNAALSA 266 >gb|ONM00355.1| 26S proteasome non-ATPase regulatory subunit 13 homolog A [Zea mays] Length = 326 Score = 75.1 bits (183), Expect = 5e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSLIGTKVEW+YH+LQAFNSGNL YQELCR+HN AL+A Sbjct: 226 INSLIGTKVEWVYHMLQAFNSGNLALYQELCRVHNAALTA 265 >dbj|BAS82957.1| Os03g0214600, partial [Oryza sativa Japonica Group] Length = 328 Score = 75.1 bits (183), Expect = 5e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSLIGTKVEW+YH+LQAFN+GNL YQELCR+HN ALSA Sbjct: 169 INSLIGTKVEWVYHMLQAFNTGNLALYQELCRVHNAALSA 208 >ref|XP_020570806.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Phalaenopsis equestris] Length = 188 Score = 72.4 bits (176), Expect = 5e-11 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = +3 Query: 1485 QINSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 QI SL+GTK EW+YHILQAFN+GNL RYQELC+++N+AL+A Sbjct: 27 QIKSLLGTKAEWIYHILQAFNTGNLARYQELCKVYNSALNA 67 >ref|XP_006644222.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Oryza brachyantha] Length = 385 Score = 75.5 bits (184), Expect = 6e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 INSLIGTKVEW+YH+LQAFN+GNL YQELCR+HN+ALSA Sbjct: 226 INSLIGTKVEWVYHMLQAFNTGNLALYQELCRVHNSALSA 265 >ref|XP_014521188.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B [Vigna radiata var. radiata] ref|XP_017427595.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Vigna angularis] gb|KOM45471.1| hypothetical protein LR48_Vigan06g077700 [Vigna angularis] dbj|BAT99684.1| hypothetical protein VIGAN_10118800 [Vigna angularis var. angularis] Length = 386 Score = 75.5 bits (184), Expect = 6e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 I SL+GTKVEWLY+ILQAFNSG+LVRYQELCR+HN ALSA Sbjct: 227 IKSLLGTKVEWLYYILQAFNSGDLVRYQELCRVHNAALSA 266 >ref|XP_002275168.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog A [Vitis vinifera] Length = 386 Score = 75.5 bits (184), Expect = 6e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 I SL+GTKVEWLY+ILQAFNSG+LVRYQELCR+HN ALSA Sbjct: 227 IKSLLGTKVEWLYYILQAFNSGDLVRYQELCRVHNAALSA 266 >gb|PPD83733.1| hypothetical protein GOBAR_DD19312 [Gossypium barbadense] Length = 347 Score = 75.1 bits (183), Expect = 6e-11 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 1488 INSLIGTKVEWLYHILQAFNSGNLVRYQELCRIHNTALSA 1607 I SL+GTKVEWLY+ILQ+FNSGNLVRY+ELCR+HN ALSA Sbjct: 197 IKSLLGTKVEWLYYILQSFNSGNLVRYEELCRVHNAALSA 236