BLASTX nr result
ID: Cheilocostus21_contig00056310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00056310 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009140789.1| hypothetical protein [Grapevine roditis leaf... 55 2e-06 >ref|YP_009140789.1| hypothetical protein [Grapevine roditis leaf discoloration-associated virus] emb|CEG62475.1| hypothetical protein [Grapevine roditis leaf discoloration-associated virus] Length = 141 Score = 55.5 bits (132), Expect = 2e-06 Identities = 36/109 (33%), Positives = 53/109 (48%), Gaps = 6/109 (5%) Frame = -1 Query: 372 DSIISQYKRLLFESS---RQPLALAELDEINRQLAGIQDTAANNAVRATELLQRIHELKL 202 D + QYK L E + ++ EI +QL I+ +A A++A E QRIH +K Sbjct: 33 DRLFQQYKDLSNERRTLHHEGISFTNEQEIRKQLGIIEAESAKKAIKALEEYQRIHAIKT 92 Query: 201 LQCHKLS---RTKTFWRDWYPVTCQIDEQLRHALRLLRDCASRAKAFQL 64 L+C S R +W D +P + DE L+ L LR+ S A F + Sbjct: 93 LECQSWSSPGRDGNYWSDHFPNVKRSDENLKRILHDLREELSDALKFSI 141