BLASTX nr result
ID: Cheilocostus21_contig00055562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00055562 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY73537.1| hypothetical protein ACMD2_02511 [Ananas comosus] 53 2e-06 >gb|OAY73537.1| hypothetical protein ACMD2_02511 [Ananas comosus] Length = 72 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 4/46 (8%) Frame = -2 Query: 335 EKAEPKRSK----IQPSDADEYEHWYVEPDIDRKAKEYIERVRNKM 210 E+AEP+ SK ++PS+ D+ ++WY +PD+DRKAKEYIE+VR M Sbjct: 22 EEAEPEHSKYERKVRPSN-DDNDYWYAKPDVDRKAKEYIEKVRRGM 66