BLASTX nr result
ID: Cheilocostus21_contig00054933
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00054933 (507 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI10527.1| Concanavalin A-like lectin/glucanase, subgroup [C... 56 6e-06 gb|KVI10535.1| hypothetical protein Ccrd_011065, partial [Cynara... 56 7e-06 >gb|KVI10527.1| Concanavalin A-like lectin/glucanase, subgroup [Cynara cardunculus var. scolymus] Length = 653 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 LEIVSRKSNTNFRPKEEFVYLLDWVSKLHSTV 101 LEIVS KSNTN+RPKEEFVYLLDWVS + TV Sbjct: 469 LEIVSGKSNTNYRPKEEFVYLLDWVSSIIQTV 500 >gb|KVI10535.1| hypothetical protein Ccrd_011065, partial [Cynara cardunculus var. scolymus] Length = 1950 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 6 LEIVSRKSNTNFRPKEEFVYLLDWVSKLHSTV 101 LEIVS KSNTN+RPKEEFVYLLDWVS + TV Sbjct: 694 LEIVSGKSNTNYRPKEEFVYLLDWVSSIIQTV 725