BLASTX nr result
ID: Cheilocostus21_contig00054681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00054681 (472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018679516.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 >ref|XP_018679516.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Musa acuminata subsp. malaccensis] Length = 582 Score = 64.7 bits (156), Expect = 4e-09 Identities = 36/56 (64%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 164 LSCMPSLTHS--PFSTFAQSFLLHLPCNIRRFSSQESSRNDLIRSVAELLKRFSNN 3 LSCMPSL PFS AQS L LP +IR SSQESSRNDL RS EL+KRF N Sbjct: 16 LSCMPSLPLPLLPFSPLAQSLLRRLPAHIRMMSSQESSRNDLFRSFVELVKRFPGN 71