BLASTX nr result
ID: Cheilocostus21_contig00054516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00054516 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018685362.1| PREDICTED: uncharacterized protein At1g04910... 58 1e-06 ref|XP_009413466.1| PREDICTED: uncharacterized protein At1g04910... 58 1e-06 >ref|XP_018685362.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 467 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +2 Query: 5 LLDMYNNKALNWKDFASSVKEVTEKNISQFACRKVLPGKPK 127 LLD+ NNK L+W DFA+SV++V EK+I Q CR+V+ GKPK Sbjct: 398 LLDLQNNKTLSWDDFATSVRQVLEKSIGQPTCRRVVAGKPK 438 >ref|XP_009413466.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 500 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +2 Query: 5 LLDMYNNKALNWKDFASSVKEVTEKNISQFACRKVLPGKPK 127 LLD+ NNK L+W DFA+SV++V EK+I Q CR+V+ GKPK Sbjct: 431 LLDLQNNKTLSWDDFATSVRQVLEKSIGQPTCRRVVAGKPK 471