BLASTX nr result
ID: Cheilocostus21_contig00054353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00054353 (492 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_080489929.1| hypothetical protein [Enterococcus faecium] 55 7e-07 ref|WP_073470604.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_073994929.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_073470585.1| hypothetical protein [Enterococcus faecium] 53 2e-06 ref|WP_073470631.1| hypothetical protein [Enterococcus faecium] 54 2e-06 ref|WP_080491688.1| 50S ribosomal protein L6 [Enterococcus faecium] 54 2e-06 ref|WP_073495475.1| hypothetical protein, partial [Enterococcus ... 53 2e-06 ref|WP_080489310.1| MULTISPECIES: hypothetical protein [Enteroco... 53 3e-06 ref|WP_073421200.1| hypothetical protein [Enterococcus faecium] 54 3e-06 ref|WP_082195859.1| hypothetical protein [Enterococcus faecium] 52 3e-06 ref|WP_082100772.1| hypothetical protein [Pseudomonas syringae p... 52 3e-06 ref|WP_073981333.1| hypothetical protein [Enterococcus faecium] 54 4e-06 ref|WP_073459383.1| hypothetical protein [Enterococcus faecalis] 52 4e-06 ref|WP_072539084.1| hypothetical protein [Enterococcus faecium] 53 4e-06 ref|WP_073340567.1| MULTISPECIES: hypothetical protein [Enteroco... 53 4e-06 ref|WP_082197626.1| hypothetical protein [Enterococcus faecium] 52 4e-06 ref|WP_073459378.1| hypothetical protein [Enterococcus faecalis] 52 4e-06 ref|WP_073985063.1| hypothetical protein [Enterococcus faecium] 52 5e-06 ref|WP_080490110.1| hypothetical protein [Enterococcus faecalis] 52 5e-06 ref|WP_073981350.1| hypothetical protein [Enterococcus faecium] 52 5e-06 >ref|WP_080489929.1| hypothetical protein [Enterococcus faecium] Length = 102 Score = 55.1 bits (131), Expect = 7e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYS 408 FFFLMIRRPPRSTLFPYTTLFRS+Y+ Sbjct: 17 FFFLMIRRPPRSTLFPYTTLFRSSYA 42 >ref|WP_073470604.1| hypothetical protein [Enterococcus faecium] Length = 93 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYSNI 402 FFFLMIRRPPRSTLFPYTTLFRS + I Sbjct: 7 FFFLMIRRPPRSTLFPYTTLFRSKFDEI 34 >ref|WP_073994929.1| hypothetical protein [Enterococcus faecium] Length = 82 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRST 414 FFFLMIRRPPRSTLFPYTTLFRST Sbjct: 15 FFFLMIRRPPRSTLFPYTTLFRST 38 >ref|WP_073470585.1| hypothetical protein [Enterococcus faecium] Length = 71 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYSNI 402 FFFLMIRRPPRSTLFPYTTLFRS+ I Sbjct: 9 FFFLMIRRPPRSTLFPYTTLFRSSLERI 36 >ref|WP_073470631.1| hypothetical protein [Enterococcus faecium] Length = 87 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRST 414 FFFLMIRRPPRSTLFPYTTLFRST Sbjct: 18 FFFLMIRRPPRSTLFPYTTLFRST 41 >ref|WP_080491688.1| 50S ribosomal protein L6 [Enterococcus faecium] Length = 89 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYSNI 402 FFFLMIRRPPRSTLFPYTTLFRS N+ Sbjct: 26 FFFLMIRRPPRSTLFPYTTLFRSLVLNV 53 >ref|WP_073495475.1| hypothetical protein, partial [Enterococcus faecalis] Length = 77 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYSNI 402 FFFLMIRRPPRSTLFPYTTLFRS S + Sbjct: 26 FFFLMIRRPPRSTLFPYTTLFRSEASKV 53 >ref|WP_080489310.1| MULTISPECIES: hypothetical protein [Enterococcus] Length = 80 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 491 YEFFFLMIRRPPRSTLFPYTTLFRS 417 + FFFLMIRRPPRSTLFPYTTLFRS Sbjct: 10 FSFFFLMIRRPPRSTLFPYTTLFRS 34 >ref|WP_073421200.1| hypothetical protein [Enterococcus faecium] Length = 113 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYSN 405 FFFLMIRRPPRSTLFPYTTLFRS+ N Sbjct: 18 FFFLMIRRPPRSTLFPYTTLFRSSIPN 44 >ref|WP_082195859.1| hypothetical protein [Enterococcus faecium] Length = 69 Score = 52.4 bits (124), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYS 408 FFFLMIRRPPRSTLFPYTTLFRS+ S Sbjct: 11 FFFLMIRRPPRSTLFPYTTLFRSSPS 36 >ref|WP_082100772.1| hypothetical protein [Pseudomonas syringae pv. coryli] Length = 69 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTY 411 FFFLMIRRPPRSTLFPYTTLFRS + Sbjct: 6 FFFLMIRRPPRSTLFPYTTLFRSRF 30 >ref|WP_073981333.1| hypothetical protein [Enterococcus faecium] Length = 114 Score = 53.5 bits (127), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 486 VFFFNDTATTEIYTLSLHDALPIYL 412 +FFFNDTATTEIYTLSLHDALPIYL Sbjct: 34 LFFFNDTATTEIYTLSLHDALPIYL 58 >ref|WP_073459383.1| hypothetical protein [Enterococcus faecalis] Length = 74 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYSNI 402 FFFLMIRRPPRSTLFPYTTLFRS I Sbjct: 13 FFFLMIRRPPRSTLFPYTTLFRSRVEEI 40 >ref|WP_072539084.1| hypothetical protein [Enterococcus faecium] Length = 91 Score = 52.8 bits (125), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 483 FFFNDTATTEIYTLSLHDALPIYLL*HIITINSR 382 FFFNDTATTEIYTLSLHDALPIY ++ INSR Sbjct: 20 FFFNDTATTEIYTLSLHDALPIYEQ-LLVKINSR 52 >ref|WP_073340567.1| MULTISPECIES: hypothetical protein [Enterococcus] Length = 108 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -2 Query: 491 YEFFFLMIRRPPRSTLFPYTTLFRS 417 Y FFFLMIRRPPRSTLFPYTTLFRS Sbjct: 4 YFFFFLMIRRPPRSTLFPYTTLFRS 28 >ref|WP_082197626.1| hypothetical protein [Enterococcus faecium] Length = 79 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTYS 408 FFFLMIRRPPRSTLFPYTTLFRS S Sbjct: 10 FFFLMIRRPPRSTLFPYTTLFRSELS 35 >ref|WP_073459378.1| hypothetical protein [Enterococcus faecalis] Length = 65 Score = 52.0 bits (123), Expect = 4e-06 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRST 414 FFFLMIRRPPRSTLFPYTTLFRS+ Sbjct: 33 FFFLMIRRPPRSTLFPYTTLFRSS 56 >ref|WP_073985063.1| hypothetical protein [Enterococcus faecium] Length = 86 Score = 52.4 bits (124), Expect = 5e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTY 411 FFFLMIRRPPRSTLFPYTTLFRS + Sbjct: 4 FFFLMIRRPPRSTLFPYTTLFRSAH 28 >ref|WP_080490110.1| hypothetical protein [Enterococcus faecalis] Length = 72 Score = 52.0 bits (123), Expect = 5e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 491 YEFFFLMIRRPPRSTLFPYTTLFRS 417 + FFFLMIRRPPRSTLFPYTTLFRS Sbjct: 14 FYFFFLMIRRPPRSTLFPYTTLFRS 38 >ref|WP_073981350.1| hypothetical protein [Enterococcus faecium] Length = 73 Score = 52.0 bits (123), Expect = 5e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 485 FFFLMIRRPPRSTLFPYTTLFRSTY 411 FFFLMIRRPPRSTLFPYTTLFRS + Sbjct: 5 FFFLMIRRPPRSTLFPYTTLFRSKW 29