BLASTX nr result
ID: Cheilocostus21_contig00054182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00054182 (1224 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA96330.1| retrotransposon protein, putative, unclassified [... 60 4e-06 >gb|ABA96330.1| retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group] Length = 506 Score = 60.5 bits (145), Expect = 4e-06 Identities = 27/64 (42%), Positives = 42/64 (65%) Frame = -1 Query: 1116 KHRGLPPKWISWTKLIMSSNDSAVNPVGVSG**FKHKQGLWQGNPIAP*FVILVIDIFAR 937 KH G PPKWI W +++ S+ SAV GV G FK ++G+ QG+P++P +L ++ R Sbjct: 92 KHMGFPPKWIEWVQMVFSTASSAVLLNGVPGNSFKCRRGVRQGDPLSPLLFVLGAELLQR 151 Query: 936 MMNK 925 ++NK Sbjct: 152 IINK 155