BLASTX nr result
ID: Cheilocostus21_contig00053714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00053714 (612 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009379960.1| PREDICTED: vacuolar protein sorting-associat... 67 9e-10 >ref|XP_009379960.1| PREDICTED: vacuolar protein sorting-associated protein 20 homolog 2 [Musa acuminata subsp. malaccensis] Length = 243 Score = 66.6 bits (161), Expect = 9e-10 Identities = 32/50 (64%), Positives = 41/50 (82%) Frame = -1 Query: 612 AESRLQRKENELLDLPDVPSRAPVMGDDGAKDISTEAATRTQVLEDPLPA 463 AES+ QR+E+ELL+LPDVPS APV+ D A+DIST +T+VLE+PLPA Sbjct: 194 AESQAQREEDELLNLPDVPSGAPVLSDGAAEDISTGTQRKTKVLEEPLPA 243