BLASTX nr result
ID: Cheilocostus21_contig00053584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00053584 (623 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB21314.1| hypothetical protein B456_004G043200 [Gossypium r... 56 6e-06 >gb|KJB21314.1| hypothetical protein B456_004G043200 [Gossypium raimondii] Length = 228 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 90 FLVNFAEDAQLTPVLRLGAGACAGIIAMSA 1 F+VN AEDAQLTP+LRLGAGACAGIIAMSA Sbjct: 5 FVVNSAEDAQLTPLLRLGAGACAGIIAMSA 34