BLASTX nr result
ID: Cheilocostus21_contig00053061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00053061 (723 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009408003.1| PREDICTED: probable plastid-lipid-associated... 78 3e-13 ref|XP_020265524.1| probable plastid-lipid-associated protein 2,... 76 2e-12 ref|XP_010943242.2| PREDICTED: probable plastid-lipid-associated... 74 7e-12 ref|XP_020594227.1| chromoplast-specific carotenoid-associated p... 71 1e-11 gb|AGN30962.1| chromoplast-specific carotenoid-associated protei... 74 1e-11 ref|XP_008803509.1| PREDICTED: probable plastid-lipid-associated... 73 1e-11 ref|XP_008780182.1| PREDICTED: probable plastid-lipid-associated... 73 2e-11 ref|XP_009392110.1| PREDICTED: chromoplast-specific carotenoid-a... 73 2e-11 gb|PIA36878.1| hypothetical protein AQUCO_03200088v1 [Aquilegia ... 71 3e-11 gb|OAY67540.1| putative plastid-lipid-associated protein 2, chlo... 72 4e-11 ref|XP_020103093.1| probable plastid-lipid-associated protein 2,... 72 4e-11 ref|XP_006849074.1| probable plastid-lipid-associated protein 2,... 72 5e-11 ref|XP_010928413.1| PREDICTED: probable plastid-lipid-associated... 72 7e-11 gb|PON52163.1| Plastid lipid-associated protein/fibrillin conser... 72 7e-11 ref|XP_008802537.1| PREDICTED: plastid-lipid-associated protein,... 69 9e-11 ref|XP_010099142.1| plastid-lipid-associated protein, chloroplas... 71 9e-11 gb|PON91308.1| Plastid lipid-associated protein/fibrillin conser... 71 9e-11 gb|PIA36879.1| hypothetical protein AQUCO_03200088v1 [Aquilegia ... 71 9e-11 ref|XP_020579411.1| chromoplast-specific carotenoid-associated p... 71 1e-10 ref|XP_020579401.1| chromoplast-specific carotenoid-associated p... 71 1e-10 >ref|XP_009408003.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Musa acuminata subsp. malaccensis] Length = 305 Score = 78.2 bits (191), Expect = 3e-13 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L KKL++LL GTDRGLKASSET AEILEVI+QLEA NPTPAPT+ALAL Sbjct: 83 LKKKLIDLLYGTDRGLKASSETRAEILEVITQLEAKNPTPAPTDALAL 130 >ref|XP_020265524.1| probable plastid-lipid-associated protein 2, chloroplastic [Asparagus officinalis] gb|ONK70264.1| uncharacterized protein A4U43_C05F31940 [Asparagus officinalis] Length = 324 Score = 76.3 bits (186), Expect = 2e-12 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L KKL ELL GTDRGLKASSET AEI+E+I+QLEA NPTPAPTEALAL Sbjct: 100 LKKKLKELLYGTDRGLKASSETRAEIVELITQLEAKNPTPAPTEALAL 147 >ref|XP_010943242.2| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Elaeis guineensis] Length = 324 Score = 74.3 bits (181), Expect = 7e-12 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++LL GTDRGLKASSET AEI+E+I+QLEA NPTPAPTEAL L Sbjct: 100 LKRKLMDLLRGTDRGLKASSETRAEIVELITQLEAKNPTPAPTEALTL 147 >ref|XP_020594227.1| chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Phalaenopsis equestris] Length = 155 Score = 70.9 bits (172), Expect = 1e-11 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++ L GTDRGLKA+SET AE+ E+ISQLEA NPTPAPTEAL+L Sbjct: 100 LKRKLIDQLFGTDRGLKATSETRAEVNEIISQLEAKNPTPAPTEALSL 147 >gb|AGN30962.1| chromoplast-specific carotenoid-associated protein [Narcissus tazetta var. chinensis] Length = 316 Score = 73.6 bits (179), Expect = 1e-11 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L K+L ELL GTDRGLKASSET AEI+E+I+QLEA NPTPAPTEAL L Sbjct: 92 LKKRLKELLYGTDRGLKASSETRAEIVELITQLEAKNPTPAPTEALTL 139 >ref|XP_008803509.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Phoenix dactylifera] Length = 256 Score = 72.8 bits (177), Expect = 1e-11 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++LL GTDRGL+ASSET AEI+E+I+QLEA NPTPAPTEAL L Sbjct: 36 LKRKLMDLLRGTDRGLEASSETRAEIVELITQLEAKNPTPAPTEALTL 83 >ref|XP_008780182.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic, partial [Phoenix dactylifera] Length = 281 Score = 72.8 bits (177), Expect = 2e-11 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL+ELL GTDRGL ASSET AEILE+I+QLE+ NPTPAPTEAL L Sbjct: 107 LKRKLMELLYGTDRGLNASSETRAEILELITQLESKNPTPAPTEALTL 154 >ref|XP_009392110.1| PREDICTED: chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Musa acuminata subsp. malaccensis] Length = 320 Score = 72.8 bits (177), Expect = 2e-11 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++LL GTDRGLKASSET AEI+E+I+QLEA NPTPAPT+AL L Sbjct: 96 LKRKLMDLLSGTDRGLKASSETRAEIVELITQLEAKNPTPAPTDALPL 143 >gb|PIA36878.1| hypothetical protein AQUCO_03200088v1 [Aquilegia coerulea] Length = 233 Score = 71.2 bits (173), Expect = 3e-11 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L K L++ L GTDRGLKASSET AEI+E+I+QLEA NPTPAPTEAL L Sbjct: 108 LKKALIDSLYGTDRGLKASSETRAEIIELITQLEAKNPTPAPTEALTL 155 >gb|OAY67540.1| putative plastid-lipid-associated protein 2, chloroplastic [Ananas comosus] Length = 328 Score = 72.4 bits (176), Expect = 4e-11 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L KKL ELL GTDRGLKASSET AEILE+I+QLEA NPTP PT+AL L Sbjct: 106 LKKKLKELLYGTDRGLKASSETRAEILELITQLEAKNPTPEPTDALPL 153 >ref|XP_020103093.1| probable plastid-lipid-associated protein 2, chloroplastic [Ananas comosus] Length = 337 Score = 72.4 bits (176), Expect = 4e-11 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L KKL ELL GTDRGLKASSET AEILE+I+QLEA NPTP PT+AL L Sbjct: 106 LKKKLKELLYGTDRGLKASSETRAEILELITQLEAKNPTPEPTDALPL 153 >ref|XP_006849074.1| probable plastid-lipid-associated protein 2, chloroplastic [Amborella trichopoda] gb|ERN10655.1| hypothetical protein AMTR_s00028p00216930 [Amborella trichopoda] Length = 322 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L K+LVE GT+RGLKASSET AEI+E+I+QLEA+NPTPAPTEAL L Sbjct: 96 LKKELVEAFYGTERGLKASSETRAEIVELITQLEALNPTPAPTEALPL 143 >ref|XP_010928413.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Elaeis guineensis] Length = 328 Score = 71.6 bits (174), Expect = 7e-11 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++LL GTDRGL+ASSET AEI+EVI+QLE NPTPAPTEAL L Sbjct: 104 LKRKLMDLLYGTDRGLQASSETRAEIVEVINQLEVRNPTPAPTEALTL 151 >gb|PON52163.1| Plastid lipid-associated protein/fibrillin conserved domain containing protein [Parasponia andersonii] Length = 329 Score = 71.6 bits (174), Expect = 7e-11 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L K LV+ GTDRGLKASSET AEI+E+I+QLEA+NPTPAPTEAL L Sbjct: 105 LKKALVDSFYGTDRGLKASSETRAEIVELITQLEALNPTPAPTEALTL 152 >ref|XP_008802537.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like [Phoenix dactylifera] Length = 190 Score = 69.3 bits (168), Expect = 9e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++LL GTDRGL ASSET AEILE+I+QLE+ NPTPAP EAL L Sbjct: 46 LKRKLMDLLYGTDRGLNASSETRAEILELITQLESKNPTPAPIEALTL 93 >ref|XP_010099142.1| plastid-lipid-associated protein, chloroplastic [Morus notabilis] gb|EXB77014.1| Plastid-lipid-associated protein [Morus notabilis] Length = 324 Score = 71.2 bits (173), Expect = 9e-11 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L K LVE GTDRGLKASSET AEI+E+I+QLEA NPTPAPTEAL+L Sbjct: 100 LKKALVESFYGTDRGLKASSETRAEIVELITQLEAQNPTPAPTEALSL 147 >gb|PON91308.1| Plastid lipid-associated protein/fibrillin conserved domain containing protein [Trema orientalis] Length = 327 Score = 71.2 bits (173), Expect = 9e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L K L++ GTDRGLKASSET AEI+E+I+QLEA+NPTPAPTEAL L Sbjct: 103 LKKALIDSFYGTDRGLKASSETRAEIVELITQLEALNPTPAPTEALTL 150 >gb|PIA36879.1| hypothetical protein AQUCO_03200088v1 [Aquilegia coerulea] Length = 332 Score = 71.2 bits (173), Expect = 9e-11 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L K L++ L GTDRGLKASSET AEI+E+I+QLEA NPTPAPTEAL L Sbjct: 108 LKKALIDSLYGTDRGLKASSETRAEIIELITQLEAKNPTPAPTEALTL 155 >ref|XP_020579411.1| chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Phalaenopsis equestris] Length = 324 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++ L GTDRGLKA+SET AE+ E+ISQLEA NPTPAPTEAL+L Sbjct: 100 LKRKLIDQLFGTDRGLKATSETRAEVNEIISQLEAKNPTPAPTEALSL 147 >ref|XP_020579401.1| chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Phalaenopsis equestris] Length = 324 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 579 LTKKLVELLEGTDRGLKASSETAAEILEVISQLEAINPTPAPTEALAL 722 L +KL++ L GTDRGLKA+SET AE+ E+ISQLEA NPTPAPTEAL+L Sbjct: 100 LKRKLIDQLFGTDRGLKATSETRAEVNEIISQLEAKNPTPAPTEALSL 147