BLASTX nr result
ID: Cheilocostus21_contig00053001
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00053001 (665 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012568789.1| PREDICTED: uncharacterized protein LOC101505... 50 3e-06 >ref|XP_012568789.1| PREDICTED: uncharacterized protein LOC101505739 [Cicer arietinum] ref|XP_012568790.1| PREDICTED: uncharacterized protein LOC101505739 [Cicer arietinum] Length = 176 Score = 50.4 bits (119), Expect(2) = 3e-06 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 2/66 (3%) Frame = -1 Query: 665 VAKARSSSIVIGGLITPIILYLGI--DISRFNHLAGGMKIDLDSYLSIKMIARVGNGFIL 492 VAKA IVIGGLITPI + LG DI + + + G +IDLDS +++K+I ++ + + L Sbjct: 45 VAKASKGDIVIGGLITPIAISLGYTNDIFKLSQVQGHTRIDLDSCIAMKLITKLHDTYHL 104 Query: 491 IFKNSN 474 + + + Sbjct: 105 LLHDGS 110 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = -3 Query: 462 LPNTASTCVHN*NNWILIAGSRARD----NIPAPLASESPIKQTHQG 334 LPN A T + N +NW+L + D +P P P TH G Sbjct: 114 LPNPARTTIQNRDNWLLSGDNSGDDQPLLQLPPPFECNRP-SSTHHG 159