BLASTX nr result
ID: Cheilocostus21_contig00052742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00052742 (504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399043.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 121 2e-32 ref|XP_009400910.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 119 1e-31 ref|XP_009397888.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 119 2e-31 ref|XP_009397887.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 112 7e-29 ref|XP_010919518.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 105 3e-26 ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 105 6e-26 ref|XP_009398832.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 103 3e-25 gb|PKU71247.1| 14 kDa proline-rich protein DC2.15 [Dendrobium ca... 102 8e-25 ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 101 1e-24 ref|XP_017232806.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 101 3e-24 ref|XP_020244852.1| 14 kDa proline-rich protein DC2.15-like [Asp... 101 3e-24 ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 100 4e-24 ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 100 6e-24 ref|XP_012852552.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 100 6e-24 ref|XP_021738140.1| 14 kDa proline-rich protein DC2.15-like [Che... 100 8e-24 ref|XP_021969019.1| 14 kDa proline-rich protein DC2.15-like [Hel... 100 8e-24 ref|WP_079403033.1| hypothetical protein [Vibrio campbellii] >gi... 100 9e-24 ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 99 2e-23 ref|XP_010933688.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 99 2e-23 ref|XP_021912440.1| 14 kDa proline-rich protein DC2.15-like [Car... 99 2e-23 >ref|XP_009399043.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata subsp. malaccensis] Length = 131 Score = 121 bits (304), Expect = 2e-32 Identities = 52/66 (78%), Positives = 62/66 (93%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 +G+GKFPKQPCECCTL+ GL+D EAAVCLCTA+ ANVLGI+L++P++LSLLLNYCGKK P Sbjct: 66 VGVGKFPKQPCECCTLIDGLLDLEAAVCLCTALKANVLGIHLNLPINLSLLLNYCGKKVP 125 Query: 324 KEFQCP 307 KEFQCP Sbjct: 126 KEFQCP 131 >ref|XP_009400910.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata subsp. malaccensis] Length = 127 Score = 119 bits (299), Expect = 1e-31 Identities = 52/65 (80%), Positives = 60/65 (92%) Frame = -1 Query: 501 GLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAPK 322 G+G FPKQPCECCTLL GLVD EAAVCLCTA+ ANVLG++L++P++LSLLLNYCGKKAP Sbjct: 63 GVGMFPKQPCECCTLLDGLVDLEAAVCLCTALKANVLGVHLNLPINLSLLLNYCGKKAPA 122 Query: 321 EFQCP 307 EFQCP Sbjct: 123 EFQCP 127 >ref|XP_009397888.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata subsp. malaccensis] Length = 130 Score = 119 bits (298), Expect = 2e-31 Identities = 52/66 (78%), Positives = 60/66 (90%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 +G+GKFPKQPCECCTLL GLVD EAAVCLCTA+ ANVLGI+L++P++ SLLLNYCGKKAP Sbjct: 65 VGVGKFPKQPCECCTLLDGLVDLEAAVCLCTAIKANVLGIHLNLPINFSLLLNYCGKKAP 124 Query: 324 KEFQCP 307 FQCP Sbjct: 125 TGFQCP 130 >ref|XP_009397887.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata subsp. malaccensis] Length = 133 Score = 112 bits (281), Expect = 7e-29 Identities = 46/66 (69%), Positives = 60/66 (90%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 +G G+FPKQPC+CC+L+ GL+D EAAVC+CTA+ AN+LG+NL+VP++LSLL+NYCGKK P Sbjct: 68 VGDGEFPKQPCQCCSLIEGLLDFEAAVCICTALKANILGVNLNVPINLSLLVNYCGKKVP 127 Query: 324 KEFQCP 307 EFQCP Sbjct: 128 AEFQCP 133 >ref|XP_010919518.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis] Length = 128 Score = 105 bits (263), Expect = 3e-26 Identities = 49/64 (76%), Positives = 56/64 (87%) Frame = -1 Query: 498 LGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAPKE 319 +GK PK+PC CTLL GLVD EAAVCLCTA+ AN+LGI L++P+DLSLLLNYCGKKAPK Sbjct: 67 IGKPPKKPC--CTLLEGLVDLEAAVCLCTALKANILGIKLNIPIDLSLLLNYCGKKAPKG 124 Query: 318 FQCP 307 FQCP Sbjct: 125 FQCP 128 >ref|XP_008786991.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera] Length = 126 Score = 105 bits (261), Expect = 6e-26 Identities = 49/66 (74%), Positives = 56/66 (84%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 + +GK PK+PC CTLL GLVD EAAVCLCTA+ AN+LGI L++PVDLSLLLNYCGKK P Sbjct: 63 VNIGKPPKKPC--CTLLEGLVDLEAAVCLCTALKANILGIKLNIPVDLSLLLNYCGKKVP 120 Query: 324 KEFQCP 307 K FQCP Sbjct: 121 KGFQCP 126 >ref|XP_009398832.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata subsp. malaccensis] Length = 152 Score = 103 bits (258), Expect = 3e-25 Identities = 43/64 (67%), Positives = 52/64 (81%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 + +GKFPKQPCECCTL+ G++D VCLC A ANVLGI+LD+P++LSLL NYCGKK P Sbjct: 87 VAIGKFPKQPCECCTLINGVIDLNTTVCLCAAPKANVLGIHLDLPINLSLLFNYCGKKVP 146 Query: 324 KEFQ 313 EFQ Sbjct: 147 SEFQ 150 >gb|PKU71247.1| 14 kDa proline-rich protein DC2.15 [Dendrobium catenatum] Length = 134 Score = 102 bits (254), Expect = 8e-25 Identities = 46/66 (69%), Positives = 57/66 (86%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 +GLGK PK+PC C+LL GLVD EAAVCLCTA+ AN+LGI+L +P+DLSLL+N+CGK+ P Sbjct: 71 IGLGKPPKKPC--CSLLKGLVDLEAAVCLCTALRANILGIHLSLPIDLSLLINFCGKRVP 128 Query: 324 KEFQCP 307 K FQCP Sbjct: 129 KGFQCP 134 >ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera] Length = 124 Score = 101 bits (252), Expect = 1e-24 Identities = 48/66 (72%), Positives = 55/66 (83%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L LGK PK+PC C+LL GLVD EAAVCLCTA+ AN+LGI L++P+ LSLLLNYCGKK P Sbjct: 61 LNLGKPPKKPC--CSLLEGLVDLEAAVCLCTALRANILGIKLNLPIHLSLLLNYCGKKTP 118 Query: 324 KEFQCP 307 K FQCP Sbjct: 119 KGFQCP 124 >ref|XP_017232806.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Daucus carota subsp. sativus] gb|KZN07644.1| hypothetical protein DCAR_008481 [Daucus carota subsp. sativus] Length = 138 Score = 101 bits (251), Expect = 3e-24 Identities = 48/66 (72%), Positives = 55/66 (83%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L +G PK+PC C+LL GLVD +AAVCLCTA+ ANVLGINL+VPVDLSL+LNYCGKK P Sbjct: 75 LVVGAAPKKPC--CSLLEGLVDLQAAVCLCTAIKANVLGINLNVPVDLSLILNYCGKKVP 132 Query: 324 KEFQCP 307 FQCP Sbjct: 133 TGFQCP 138 >ref|XP_020244852.1| 14 kDa proline-rich protein DC2.15-like [Asparagus officinalis] Length = 140 Score = 101 bits (251), Expect = 3e-24 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = -1 Query: 498 LGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAPKE 319 +G PK+PC C+LLG LVD EAAVCLCTAV N+LG+NL++PVDLSLLLNYCGKK PK Sbjct: 79 IGNPPKKPC--CSLLGNLVDLEAAVCLCTAVKLNLLGLNLNIPVDLSLLLNYCGKKYPKG 136 Query: 318 FQCP 307 FQCP Sbjct: 137 FQCP 140 >ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis] Length = 129 Score = 100 bits (249), Expect = 4e-24 Identities = 46/63 (73%), Positives = 53/63 (84%) Frame = -1 Query: 498 LGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAPKE 319 +G PK+PC C+LL GLVD EAAVCLCTA+ AN+LGINL++PVDLSLLLNYCGKK P Sbjct: 68 IGTPPKEPC--CSLLSGLVDLEAAVCLCTAIKANILGINLNIPVDLSLLLNYCGKKVPSG 125 Query: 318 FQC 310 FQC Sbjct: 126 FQC 128 >ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera] Length = 127 Score = 100 bits (248), Expect = 6e-24 Identities = 46/66 (69%), Positives = 54/66 (81%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L LGK PK+PC C+L+ GL D EAAVCLCTA+ AN+LGI L++PVDLSLL+NYCGKK P Sbjct: 64 LNLGKPPKKPC--CSLIKGLADLEAAVCLCTALKANILGIKLNIPVDLSLLINYCGKKVP 121 Query: 324 KEFQCP 307 FQCP Sbjct: 122 TGFQCP 127 >ref|XP_012852552.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Erythranthe guttata] gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata] Length = 132 Score = 100 bits (248), Expect = 6e-24 Identities = 49/65 (75%), Positives = 53/65 (81%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L +G PK PC C+L+GGLVD EAAVCLCTAV ANVLGINL+VPV LSLLLNYCGKK P Sbjct: 69 LVVGSPPKTPC--CSLIGGLVDLEAAVCLCTAVKANVLGINLNVPVSLSLLLNYCGKKVP 126 Query: 324 KEFQC 310 FQC Sbjct: 127 SGFQC 131 >ref|XP_021738140.1| 14 kDa proline-rich protein DC2.15-like [Chenopodium quinoa] Length = 164 Score = 100 bits (250), Expect = 8e-24 Identities = 47/66 (71%), Positives = 53/66 (80%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L +G PK PC C L+GGLVD EAAVCLCTA+ AN+LGINLD+P+ LSLLLNYCGKK P Sbjct: 101 LVVGTPPKTPC--CPLIGGLVDLEAAVCLCTAIKANILGINLDIPLSLSLLLNYCGKKVP 158 Query: 324 KEFQCP 307 FQCP Sbjct: 159 TGFQCP 164 >ref|XP_021969019.1| 14 kDa proline-rich protein DC2.15-like [Helianthus annuus] Length = 129 Score = 99.8 bits (247), Expect = 8e-24 Identities = 49/65 (75%), Positives = 53/65 (81%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L +G PK PC C+LLG LVD EAAVCLCTA+ ANVLGINLDVPV LSLLLNYCGKK P Sbjct: 66 LVVGTPPKTPC--CSLLGDLVDLEAAVCLCTAIKANVLGINLDVPVSLSLLLNYCGKKVP 123 Query: 324 KEFQC 310 + FQC Sbjct: 124 QGFQC 128 >ref|WP_079403033.1| hypothetical protein [Vibrio campbellii] gb|OPH47445.1| hypothetical protein B4U81_25735 [Vibrio campbellii] Length = 170 Score = 100 bits (250), Expect = 9e-24 Identities = 47/64 (73%), Positives = 53/64 (82%) Frame = -1 Query: 498 LGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAPKE 319 +G PK+PC C+LL GLVD EAAVCLC A+ AN+LGINL+VPVDLSLLLNYCGKK P Sbjct: 109 IGXPPKEPC--CSLLNGLVDLEAAVCLCIAIKANILGINLNVPVDLSLLLNYCGKKVPTG 166 Query: 318 FQCP 307 FQCP Sbjct: 167 FQCP 170 >ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri] Length = 142 Score = 99.4 bits (246), Expect = 2e-23 Identities = 47/63 (74%), Positives = 51/63 (80%) Frame = -1 Query: 498 LGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAPKE 319 +G PK PC C+L+GGL D EAAVCLCTA+ ANVLGINLDVPV LSLLLNYCGK PK Sbjct: 81 VGTPPKTPC--CSLIGGLTDLEAAVCLCTAIKANVLGINLDVPVSLSLLLNYCGKSVPKG 138 Query: 318 FQC 310 FQC Sbjct: 139 FQC 141 >ref|XP_010933688.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis] Length = 131 Score = 99.0 bits (245), Expect = 2e-23 Identities = 46/66 (69%), Positives = 53/66 (80%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L LG PK+PC CTLL GL D E AVCLCTA+ AN+LGI+L+VP+DLSLL+NYCGK AP Sbjct: 68 LNLGNPPKKPC--CTLLQGLADLEVAVCLCTALKANILGISLNVPIDLSLLINYCGKNAP 125 Query: 324 KEFQCP 307 FQCP Sbjct: 126 TGFQCP 131 >ref|XP_021912440.1| 14 kDa proline-rich protein DC2.15-like [Carica papaya] Length = 126 Score = 98.6 bits (244), Expect = 2e-23 Identities = 49/65 (75%), Positives = 51/65 (78%) Frame = -1 Query: 504 LGLGKFPKQPCECCTLLGGLVDAEAAVCLCTAVNANVLGINLDVPVDLSLLLNYCGKKAP 325 L LG PK PC CTLL GLVD EAAVCLCTA+ ANVLGINL+VPV LSLLLNYCGK P Sbjct: 63 LVLGSPPKSPC--CTLLDGLVDLEAAVCLCTAIKANVLGINLNVPVSLSLLLNYCGKTVP 120 Query: 324 KEFQC 310 FQC Sbjct: 121 SGFQC 125