BLASTX nr result
ID: Cheilocostus21_contig00052562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00052562 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009381024.1| PREDICTED: uncharacterized protein LOC103969... 80 3e-14 ref|XP_010916047.1| PREDICTED: negative regulator of systemic ac... 64 7e-09 ref|XP_010916046.1| PREDICTED: negative regulator of systemic ac... 64 7e-09 ref|XP_010916045.1| PREDICTED: negative regulator of systemic ac... 64 7e-09 ref|XP_008784442.1| PREDICTED: uncharacterized protein LOC103703... 59 5e-07 >ref|XP_009381024.1| PREDICTED: uncharacterized protein LOC103969260 isoform X1 [Musa acuminata subsp. malaccensis] Length = 485 Score = 79.7 bits (195), Expect = 3e-14 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +1 Query: 142 LQGSRKINFKSLVRDCLSILLKRCHHSMPNNFQQLRNSEDTSPQSNHD 285 L GSRK+NFKSLVRDC+SILLKRCHH++PNN Q LR+SEDT QS+ D Sbjct: 227 LLGSRKLNFKSLVRDCMSILLKRCHHNIPNNHQDLRSSEDTCSQSSQD 274 >ref|XP_010916047.1| PREDICTED: negative regulator of systemic acquired resistance SNI1 isoform X3 [Elaeis guineensis] ref|XP_019704950.1| PREDICTED: negative regulator of systemic acquired resistance SNI1 isoform X3 [Elaeis guineensis] Length = 413 Score = 64.3 bits (155), Expect = 7e-09 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +1 Query: 142 LQGSRKINFKSLVRDCLSILLKRCHHSMPNNFQQLRNSEDTSPQSNHDS 288 L GSRK+NFKSLVRDC+SI+ +RCHH + NFQ LR +D+ + H+S Sbjct: 154 LLGSRKLNFKSLVRDCMSIMCRRCHHHIEKNFQDLRYVKDSRDKEAHNS 202 >ref|XP_010916046.1| PREDICTED: negative regulator of systemic acquired resistance SNI1 isoform X2 [Elaeis guineensis] Length = 469 Score = 64.3 bits (155), Expect = 7e-09 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +1 Query: 142 LQGSRKINFKSLVRDCLSILLKRCHHSMPNNFQQLRNSEDTSPQSNHDS 288 L GSRK+NFKSLVRDC+SI+ +RCHH + NFQ LR +D+ + H+S Sbjct: 211 LLGSRKLNFKSLVRDCMSIMCRRCHHHIEKNFQDLRYVKDSRDKEAHNS 259 >ref|XP_010916045.1| PREDICTED: negative regulator of systemic acquired resistance SNI1 isoform X1 [Elaeis guineensis] Length = 470 Score = 64.3 bits (155), Expect = 7e-09 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = +1 Query: 142 LQGSRKINFKSLVRDCLSILLKRCHHSMPNNFQQLRNSEDTSPQSNHDS 288 L GSRK+NFKSLVRDC+SI+ +RCHH + NFQ LR +D+ + H+S Sbjct: 211 LLGSRKLNFKSLVRDCMSIMCRRCHHHIEKNFQDLRYVKDSRDKEAHNS 259 >ref|XP_008784442.1| PREDICTED: uncharacterized protein LOC103703380 [Phoenix dactylifera] Length = 469 Score = 58.9 bits (141), Expect = 5e-07 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 142 LQGSRKINFKSLVRDCLSILLKRCHHSMPNNFQQLRNSEDTSPQSNHDS 288 L GSRK+NFK+LVRDC+SI+ +RCHH + N Q LR +D+ + H S Sbjct: 211 LLGSRKLNFKTLVRDCMSIMYRRCHHHIAKNVQDLRYVKDSCDKEAHIS 259