BLASTX nr result
ID: Cheilocostus21_contig00052537
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00052537 (444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018674396.1| PREDICTED: pentatricopeptide repeat-containi... 125 2e-30 ref|XP_009420709.1| PREDICTED: pentatricopeptide repeat-containi... 125 2e-30 ref|XP_008809472.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 116 3e-27 ref|XP_010908164.1| PREDICTED: pentatricopeptide repeat-containi... 112 5e-26 gb|OAY78852.1| Pentatricopeptide repeat-containing protein DOT4,... 107 5e-24 ref|XP_020091644.1| pentatricopeptide repeat-containing protein ... 107 5e-24 ref|XP_022879414.1| pentatricopeptide repeat-containing protein ... 94 3e-19 ref|XP_008226293.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-18 ref|XP_021832308.1| putative pentatricopeptide repeat-containing... 91 3e-18 gb|OVA05194.1| Pentatricopeptide repeat [Macleaya cordata] 90 6e-18 gb|PIA52447.1| hypothetical protein AQUCO_01000371v1 [Aquilegia ... 90 6e-18 ref|XP_017241718.1| PREDICTED: pentatricopeptide repeat-containi... 88 2e-17 ref|XP_007213606.1| putative pentatricopeptide repeat-containing... 87 4e-17 gb|PIN21508.1| hypothetical protein CDL12_05778 [Handroanthus im... 87 4e-17 ref|XP_012852768.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_023874640.1| pentatricopeptide repeat-containing protein ... 87 6e-17 gb|KVI09034.1| Pentatricopeptide repeat-containing protein [Cyna... 87 7e-17 ref|XP_018506254.1| PREDICTED: pentatricopeptide repeat-containi... 86 2e-16 ref|XP_010255012.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-16 gb|PKU64727.1| Pentatricopeptide repeat-containing protein [Dend... 85 3e-16 >ref|XP_018674396.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 684 Score = 125 bits (313), Expect = 2e-30 Identities = 58/86 (67%), Positives = 71/86 (82%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M HK P+++LPPNV+L+FL YL SG L+RARDLFD+IPHPDLRSLTIL+SA+T+ N P Sbjct: 1 MVHKFPVVDLPPNVTLRFLRSYLSSGQLERARDLFDRIPHPDLRSLTILISAFTKNNLPK 60 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E IR YR R +K ++PDRLVLLSVA Sbjct: 61 ESIRFYRTLRENKGLEPDRLVLLSVA 86 >ref|XP_009420709.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 692 Score = 125 bits (313), Expect = 2e-30 Identities = 58/86 (67%), Positives = 71/86 (82%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M HK P+++LPPNV+L+FL YL SG L+RARDLFD+IPHPDLRSLTIL+SA+T+ N P Sbjct: 1 MVHKFPVVDLPPNVTLRFLRSYLSSGQLERARDLFDRIPHPDLRSLTILISAFTKNNLPK 60 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E IR YR R +K ++PDRLVLLSVA Sbjct: 61 ESIRFYRTLRENKGLEPDRLVLLSVA 86 >ref|XP_008809472.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g04780-like [Phoenix dactylifera] Length = 691 Score = 116 bits (290), Expect = 3e-27 Identities = 58/86 (67%), Positives = 69/86 (80%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M LPI NLPP++S+ FL YL +G LDRAR+LFDKIPHPDLRSLT+L+SAYT+Q P Sbjct: 1 MPPTLPI-NLPPHLSINFLRSYLSAGRLDRARELFDKIPHPDLRSLTVLISAYTKQGHPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I LY + R+ KD+KPDRLVLLSVA Sbjct: 60 ESISLYWKLRSEKDLKPDRLVLLSVA 85 >ref|XP_010908164.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Elaeis guineensis] Length = 691 Score = 112 bits (281), Expect = 5e-26 Identities = 56/86 (65%), Positives = 67/86 (77%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 MT KLPI +LPP++S+ FL YL +G LDRAR+LFDKIPHPDLRSLT+L+ YT+Q Sbjct: 1 MTPKLPI-HLPPHLSINFLKSYLNAGQLDRARELFDKIPHPDLRSLTVLICGYTKQGLSK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I LY + R KD+KPDRLVLLSVA Sbjct: 60 ESISLYWKLRREKDLKPDRLVLLSVA 85 >gb|OAY78852.1| Pentatricopeptide repeat-containing protein DOT4, chloroplastic [Ananas comosus] Length = 675 Score = 107 bits (266), Expect = 5e-24 Identities = 54/85 (63%), Positives = 64/85 (75%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KL I N+PPNV LKF+ YL SG LDRARDLFD+IP PDLRSLT+L +AYT+Q P Sbjct: 1 MLQKLSI-NIPPNVILKFIKSYLISGELDRARDLFDRIPKPDLRSLTMLFTAYTKQGRPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSV 439 E + LYRR R+ I PD+LVLLS+ Sbjct: 60 ESVNLYRRLRSENRIDPDKLVLLSI 84 >ref|XP_020091644.1| pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Ananas comosus] Length = 691 Score = 107 bits (266), Expect = 5e-24 Identities = 54/85 (63%), Positives = 64/85 (75%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KL I N+PPNV LKF+ YL SG LDRARDLFD+IP PDLRSLT+L +AYT+Q P Sbjct: 1 MLQKLSI-NIPPNVILKFIKSYLISGELDRARDLFDRIPKPDLRSLTMLFTAYTKQGRPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSV 439 E + LYRR R+ I PD+LVLLS+ Sbjct: 60 ESVNLYRRLRSENRIDPDKLVLLSI 84 >ref|XP_022879414.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] ref|XP_022879415.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] ref|XP_022879416.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] Length = 687 Score = 93.6 bits (231), Expect = 3e-19 Identities = 46/86 (53%), Positives = 60/86 (69%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M K+P NLPP++++KF+ YL SG L RAR LFDKI PD++ T+L++AYTRQ P Sbjct: 1 MISKIPT-NLPPHLNIKFIKNYLNSGDLKRARQLFDKISEPDIQLWTLLITAYTRQGHPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I+LY FR + PD+L LLSVA Sbjct: 60 EAIKLYAEFRNRGKVNPDKLALLSVA 85 >ref|XP_008226293.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Prunus mume] Length = 686 Score = 90.9 bits (224), Expect = 2e-18 Identities = 48/86 (55%), Positives = 60/86 (69%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KLP N+P ++SL+FL Y SG L RAR LFD+IPHPDLR+ T+L+S +TR FP Sbjct: 1 MLSKLPA-NVPSHLSLRFLKIYCNSGDLQRARHLFDQIPHPDLRAWTVLISGHTRHGFPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I+LY R + I PD L+LLSVA Sbjct: 60 ESIKLYTSLR-GRHIVPDNLLLLSVA 84 >ref|XP_021832308.1| putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Prunus avium] Length = 686 Score = 90.5 bits (223), Expect = 3e-18 Identities = 48/86 (55%), Positives = 60/86 (69%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KLP N+P ++SL+FL Y SG L RAR LFD+IPHPDLR+ T+L+S +TR FP Sbjct: 1 MLSKLPA-NVPSHLSLRFLKIYCNSGDLQRARRLFDQIPHPDLRAWTVLISGHTRHGFPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I+LY R + I PD L+LLSVA Sbjct: 60 ESIKLYTSLR-GRHIVPDNLLLLSVA 84 >gb|OVA05194.1| Pentatricopeptide repeat [Macleaya cordata] Length = 686 Score = 89.7 bits (221), Expect = 6e-18 Identities = 46/78 (58%), Positives = 58/78 (74%) Frame = +2 Query: 209 NLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPNECIRLYRR 388 NLP ++SLKFL Y SG ++ AR +FDKIP PDL S TIL+SA+T Q FP E I LY+ Sbjct: 8 NLPSHLSLKFLKIYANSGDIESARRVFDKIPQPDLPSWTILISAHTNQGFPKESIELYKD 67 Query: 389 FRTSKDIKPDRLVLLSVA 442 R ++I+PD+LVLLSVA Sbjct: 68 LR-KRNIEPDKLVLLSVA 84 >gb|PIA52447.1| hypothetical protein AQUCO_01000371v1 [Aquilegia coerulea] Length = 687 Score = 89.7 bits (221), Expect = 6e-18 Identities = 43/77 (55%), Positives = 56/77 (72%) Frame = +2 Query: 209 NLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPNECIRLYRR 388 NLP N+ KFL YL +G L+ AR LFDKIP PDL++ TIL++AYT+Q +P E I+LY + Sbjct: 8 NLPANLCQKFLKTYLNTGDLESARHLFDKIPQPDLKTWTILVTAYTKQGYPEESIKLYTK 67 Query: 389 FRTSKDIKPDRLVLLSV 439 R +I+ D LVLLSV Sbjct: 68 LRQKNNIRVDSLVLLSV 84 >ref|XP_017241718.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Daucus carota subsp. sativus] gb|KZN02195.1| hypothetical protein DCAR_010949 [Daucus carota subsp. sativus] Length = 691 Score = 88.2 bits (217), Expect = 2e-17 Identities = 46/82 (56%), Positives = 59/82 (71%) Frame = +2 Query: 194 KLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPNECI 373 KLP NLPP++SLKF+ YL SG L RAR LFDKI PD+ S T+L++AYT+Q E + Sbjct: 9 KLPT-NLPPHLSLKFIKIYLNSGDLLRARQLFDKILQPDIHSCTVLINAYTKQGHAKEAL 67 Query: 374 RLYRRFRTSKDIKPDRLVLLSV 439 LY R ++DI+PD+L LLSV Sbjct: 68 NLYSELR-ARDIQPDKLALLSV 88 >ref|XP_007213606.1| putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Prunus persica] gb|ONI12073.1| hypothetical protein PRUPE_4G142900 [Prunus persica] Length = 686 Score = 87.4 bits (215), Expect = 4e-17 Identities = 47/86 (54%), Positives = 59/86 (68%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KLP N+P ++SL+FL SG L RAR LFD+IPHPDLR+ T+L+S +TR FP Sbjct: 1 MLSKLPA-NVPSHLSLRFLKICCNSGDLQRARHLFDQIPHPDLRAWTVLISGHTRHGFPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I+LY R + I PD L+LLSVA Sbjct: 60 ESIKLYTSLR-GRHIVPDNLLLLSVA 84 >gb|PIN21508.1| hypothetical protein CDL12_05778 [Handroanthus impetiginosus] Length = 687 Score = 87.4 bits (215), Expect = 4e-17 Identities = 43/86 (50%), Positives = 60/86 (69%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M K+P NLPP++++KF+ YL SG + RAR LFD I PD++S T+L+SAYTR N Sbjct: 1 MLSKVPT-NLPPHLNIKFIRKYLNSGDIARARQLFDVISEPDVQSWTLLISAYTRNGLCN 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E + LY + SK IKPD+L +L+V+ Sbjct: 60 EAVNLYTEVKKSKTIKPDKLAILAVS 85 >ref|XP_012852768.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Erythranthe guttata] gb|EYU44325.1| hypothetical protein MIMGU_mgv1a002336mg [Erythranthe guttata] Length = 687 Score = 87.4 bits (215), Expect = 4e-17 Identities = 44/86 (51%), Positives = 59/86 (68%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M K+P NLPP++++ F+ YL SG L RAR LFD I HPD++S T+L+SAYTR Sbjct: 1 MLSKVPT-NLPPHLNINFIKKYLNSGDLARARQLFDGISHPDVQSWTLLISAYTRSGRCR 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I+LY R S+ I PD+ V+L+VA Sbjct: 60 EAIKLYTELRNSRKINPDKFVILAVA 85 >ref|XP_023874640.1| pentatricopeptide repeat-containing protein At2g13600-like [Quercus suber] gb|POE83287.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 557 Score = 86.7 bits (213), Expect = 6e-17 Identities = 49/86 (56%), Positives = 61/86 (70%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KLPI +LP +SLKF+ SG L RAR +FD+IP PDLR+ TIL+SAYT+ FP Sbjct: 1 MPPKLPI-SLPAPLSLKFIKEACNSGDLQRARHMFDQIPQPDLRTWTILISAYTQHGFPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E I+LY R +++I PDRLVLLS A Sbjct: 60 ESIKLYNLVR-AQEIIPDRLVLLSAA 84 >gb|KVI09034.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 686 Score = 86.7 bits (213), Expect = 7e-17 Identities = 47/85 (55%), Positives = 60/85 (70%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KLP NLPP++SLKF+ Y SG L RAR LFDKI +PD+ S T+L+SAYTR+ Sbjct: 1 MLPKLPS-NLPPHLSLKFIKSYCDSGDLRRARQLFDKITNPDVYSWTVLISAYTRRGLQK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSV 439 E I LY + R ++I+PD+ VLLSV Sbjct: 60 EAINLYTQLR-DREIQPDKFVLLSV 83 >ref|XP_018506254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Pyrus x bretschneideri] Length = 686 Score = 85.5 bits (210), Expect = 2e-16 Identities = 45/86 (52%), Positives = 58/86 (67%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M KLP N+PP++SL+FL + SG L RAR LFD+IP PDLR+ T+L+S YTR P Sbjct: 1 MLSKLPT-NVPPHLSLRFLKIFCNSGDLQRARHLFDQIPEPDLRAWTLLISGYTRHGLPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLSVA 442 E + LY R ++ I PD +LLSVA Sbjct: 60 ESVSLYASLR-ARRIAPDSFLLLSVA 84 >ref|XP_010255012.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Nelumbo nucifera] Length = 686 Score = 85.1 bits (209), Expect = 2e-16 Identities = 44/84 (52%), Positives = 59/84 (70%) Frame = +2 Query: 185 MTHKLPILNLPPNVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPN 364 M K+P LPPN+SLKF+ Y+ SG L A LF+KIP PDLRS TIL++ +T+Q FP Sbjct: 1 MPSKVPTC-LPPNISLKFIKSYVNSGDLGCALQLFNKIPVPDLRSWTILITTHTKQGFPK 59 Query: 365 ECIRLYRRFRTSKDIKPDRLVLLS 436 E ++LY R K ++PD+LVLL+ Sbjct: 60 EALKLYAELRLRK-VEPDKLVLLA 82 >gb|PKU64727.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 673 Score = 84.7 bits (208), Expect = 3e-16 Identities = 41/71 (57%), Positives = 53/71 (74%) Frame = +2 Query: 230 LKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNFPNECIRLYRRFRTSKDI 409 +K L YL SG LD AR LFDKIP+PDLR+LT+LLSAY++ P + I LYR+ K++ Sbjct: 1 MKSLSSYLHSGQLDLARKLFDKIPNPDLRALTLLLSAYSKHGRPKQSIALYRKLCKEKNL 60 Query: 410 KPDRLVLLSVA 442 +PDR V+LSVA Sbjct: 61 QPDRYVILSVA 71