BLASTX nr result
ID: Cheilocostus21_contig00052480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00052480 (697 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009388481.1| PREDICTED: vegetative cell wall protein gp1-... 63 4e-08 ref|XP_009402662.1| PREDICTED: proline-rich receptor-like protei... 61 2e-07 ref|XP_009402812.1| PREDICTED: leucine-rich repeat extensin-like... 57 4e-06 ref|XP_019703701.1| PREDICTED: vegetative cell wall protein gp1-... 56 7e-06 >ref|XP_009388481.1| PREDICTED: vegetative cell wall protein gp1-like [Musa acuminata subsp. malaccensis] Length = 270 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 328 DVEDHVRFHETVIPVPHGQHLAALSVDEDFRVHEVVK 218 DVEDHV HETV+P PHG+ L ALS+DED +VHEV+K Sbjct: 192 DVEDHVHIHETVVPGPHGEQLVALSIDEDIKVHEVIK 228 >ref|XP_009402662.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Musa acuminata subsp. malaccensis] Length = 225 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = -1 Query: 328 DVEDHVRFHETVIPVPHGQHLAALSVDEDFRVHEVVK 218 DVEDHV HET +P PHGQ LA LS+DED +VHEV K Sbjct: 151 DVEDHVHVHETAVPGPHGQQLATLSIDEDIKVHEVFK 187 >ref|XP_009402812.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Musa acuminata subsp. malaccensis] Length = 233 Score = 57.0 bits (136), Expect = 4e-06 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -1 Query: 328 DVEDHVRFHETVIPVPHGQHLAALSVDEDFRVHEVVK 218 DVED+ HETV+P PHGQ LA LS++ED +VHEV K Sbjct: 159 DVEDYAHVHETVVPGPHGQQLATLSIEEDIKVHEVFK 195 >ref|XP_019703701.1| PREDICTED: vegetative cell wall protein gp1-like [Elaeis guineensis] Length = 232 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -1 Query: 328 DVEDHVRFHETVIPVPHGQHLAALSVDEDFRVHEVVK 218 +VEDH+R HET++P PHG L A++VDED RV EV+K Sbjct: 165 NVEDHLRVHETIVPGPHGSQLVAMAVDEDLRVQEVMK 201