BLASTX nr result
ID: Cheilocostus21_contig00052325
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00052325 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018685597.1| PREDICTED: uncharacterized protein At4g26450... 53 1e-08 >ref|XP_018685597.1| PREDICTED: uncharacterized protein At4g26450 [Musa acuminata subsp. malaccensis] Length = 645 Score = 53.1 bits (126), Expect(2) = 1e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 362 YNSAISDYLGAAMSRSPSVQGDLNNLQVRMGLHGGD 255 Y+ AISDYLGA MS SPSVQ DLNNLQV + LHG + Sbjct: 577 YSLAISDYLGADMSCSPSVQADLNNLQVGIDLHGAE 612 Score = 33.9 bits (76), Expect(2) = 1e-08 Identities = 13/26 (50%), Positives = 22/26 (84%) Frame = -3 Query: 439 NEMMYPMEHVLNLPANSEYIPVIQDT 362 NE++YP+E+V+N +S+ +PVIQD+ Sbjct: 551 NELIYPVENVMNHTTHSDDLPVIQDS 576