BLASTX nr result
ID: Cheilocostus21_contig00052227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00052227 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009411630.1| PREDICTED: homeobox protein knotted-1-like 1... 58 6e-07 ref|XP_009382495.1| PREDICTED: homeobox protein knotted-1-like 1... 57 9e-07 >ref|XP_009411630.1| PREDICTED: homeobox protein knotted-1-like 1 [Musa acuminata subsp. malaccensis] ref|XP_009411631.1| PREDICTED: homeobox protein knotted-1-like 1 [Musa acuminata subsp. malaccensis] ref|XP_018686537.1| PREDICTED: homeobox protein knotted-1-like 1 [Musa acuminata subsp. malaccensis] ref|XP_018686538.1| PREDICTED: homeobox protein knotted-1-like 1 [Musa acuminata subsp. malaccensis] ref|XP_018686539.1| PREDICTED: homeobox protein knotted-1-like 1 [Musa acuminata subsp. malaccensis] Length = 307 Score = 57.8 bits (138), Expect = 6e-07 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 4/37 (10%) Frame = +3 Query: 354 MEDLFSIHPGILRGGDAP----AGSCQGTSEASEVTG 452 MEDL+SIHPGILRGGD P A SCQG+S+ASEVTG Sbjct: 1 MEDLYSIHPGILRGGDTPAVGSASSCQGSSDASEVTG 37 >ref|XP_009382495.1| PREDICTED: homeobox protein knotted-1-like 1 [Musa acuminata subsp. malaccensis] ref|XP_009382496.1| PREDICTED: homeobox protein knotted-1-like 1 [Musa acuminata subsp. malaccensis] Length = 316 Score = 57.4 bits (137), Expect = 9e-07 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 4/37 (10%) Frame = +3 Query: 354 MEDLFSIHPGILRGGDAP----AGSCQGTSEASEVTG 452 MEDLFSIHPGIL GG+ P A SCQGTSEASEVTG Sbjct: 1 MEDLFSIHPGILGGGETPAVGLASSCQGTSEASEVTG 37