BLASTX nr result
ID: Cheilocostus21_contig00052102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00052102 (669 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009406470.1| PREDICTED: VQ motif-containing protein 31-li... 72 3e-12 ref|XP_009404301.1| PREDICTED: VQ motif-containing protein 31-li... 70 2e-11 ref|XP_021839515.1| VQ motif-containing protein 31-like [Spinaci... 61 7e-08 ref|XP_023637489.1| VQ motif-containing protein 31 isoform X2 [C... 56 2e-06 ref|XP_013629569.1| PREDICTED: VQ motif-containing protein 31 is... 56 2e-06 ref|NP_001318511.1| VQ motif-containing protein [Arabidopsis tha... 56 2e-06 ref|XP_023890141.1| VQ motif-containing protein 31-like [Quercus... 57 2e-06 ref|XP_024012159.1| VQ motif-containing protein 31 isoform X2 [E... 56 2e-06 ref|XP_018474518.1| PREDICTED: VQ motif-containing protein 31 is... 56 2e-06 ref|XP_013629568.1| PREDICTED: VQ motif-containing protein 31 is... 56 2e-06 ref|XP_018474517.1| PREDICTED: VQ motif-containing protein 31 is... 56 3e-06 ref|XP_006290199.1| VQ motif-containing protein 31 isoform X1 [C... 56 3e-06 ref|NP_850793.1| VQ motif-containing protein [Arabidopsis thalia... 56 4e-06 ref|XP_018474516.1| PREDICTED: VQ motif-containing protein 31 is... 56 4e-06 ref|XP_013609860.1| PREDICTED: VQ motif-containing protein 31-li... 56 4e-06 ref|XP_013629567.1| PREDICTED: VQ motif-containing protein 31 is... 56 4e-06 ref|XP_009122454.1| PREDICTED: VQ motif-containing protein 31 is... 56 4e-06 ref|XP_006399346.1| VQ motif-containing protein 31 isoform X1 [E... 56 4e-06 gb|ABK28690.1| unknown, partial [Arabidopsis thaliana] 56 4e-06 ref|XP_022549470.1| VQ motif-containing protein 31-like isoform ... 56 4e-06 >ref|XP_009406470.1| PREDICTED: VQ motif-containing protein 31-like [Musa acuminata subsp. malaccensis] Length = 171 Score = 72.4 bits (176), Expect = 3e-12 Identities = 56/160 (35%), Positives = 68/160 (42%), Gaps = 2/160 (1%) Frame = +3 Query: 87 YVRADAAAFKDLVQRLTAGAADASKHLQLAXXXXXXXXXXXXSVAASNRGFGLKRLHQPX 266 +VRADA FK+LVQRLT H + ++ + GLKRLH+ Sbjct: 20 FVRADATTFKELVQRLTGPNERDGAHRPVVAPAPP---------SSPTKLSGLKRLHERR 70 Query: 267 XXXXXXXXXXXPMAISLPTSPRV--GAXXXXXXXXXXXXADLCLLEEGGHVVDXXXXXXX 440 P + S P +P V + A L + E G Sbjct: 71 QRSRPKLTILKPGSTSKPPTPAVLSPSVTGASASPSADFAGLNICEHKGVDGADELDEEE 130 Query: 441 XXXXXXXRRFYLHPSPRSRSRMVKPELLTLFPLTSPNSGQ 560 RRFYLHPSPRSRSR +PELL LFPLTSP S Q Sbjct: 131 EERAIKERRFYLHPSPRSRSRNPEPELLPLFPLTSPRSHQ 170 >ref|XP_009404301.1| PREDICTED: VQ motif-containing protein 31-like [Musa acuminata subsp. malaccensis] Length = 169 Score = 70.1 bits (170), Expect = 2e-11 Identities = 62/166 (37%), Positives = 72/166 (43%), Gaps = 5/166 (3%) Frame = +3 Query: 87 YVRADAAAFKDLVQRLTAGAA--DASKHLQLAXXXXXXXXXXXXSVAASNRGFGLKRLH- 257 +VR DAA FK+LVQRLTAG DA KH S + + GLKR H Sbjct: 15 FVRTDAATFKELVQRLTAGPQIDDAHKH---------HPAPSSSSSSHKLKTPGLKRQHE 65 Query: 258 QPXXXXXXXXXXXXPMAISLPTSPRV--GAXXXXXXXXXXXXADLCLLEEGGHVVDXXXX 431 Q P +SLP SP A A L + EEGG+ V Sbjct: 66 QRRGVPRRRFTALRPRPLSLPASPAAISPAMSPVVASPSTSFARLHIREEGGNKVQ-VDP 124 Query: 432 XXXXXXXXXXRRFYLHPSPRSRSRMVKPELLTLFPLTSPNSGQQQP 569 RRFYLHPSPR R+ PELL LFPL+S + QP Sbjct: 125 NEEEEKAIKERRFYLHPSPRPRNAEA-PELLPLFPLSSSSQPSDQP 169 >ref|XP_021839515.1| VQ motif-containing protein 31-like [Spinacia oleracea] Length = 185 Score = 60.8 bits (146), Expect = 7e-08 Identities = 55/178 (30%), Positives = 72/178 (40%), Gaps = 19/178 (10%) Frame = +3 Query: 87 YVRADAAAFKDLVQRLTAGAADASKHLQLAXXXXXXXXXXXXSVAASNRGFGLKR----L 254 +V+AD FKD+VQRLT G++DA+ A V A+ G+KR L Sbjct: 18 FVQADTTTFKDVVQRLT-GSSDAAAAAAAAVH----------EVTAAKGNIGVKRPEFKL 66 Query: 255 HQPXXXXXXXXXXXXPMAI------------SLPTSPRVGAXXXXXXXXXXXXADLCLLE 398 H+ P+ I S +S + L L E Sbjct: 67 HERRQYKAKLEIIKPPLNIKHGQQHFQEHRFSPSSSGNRVRQKSPMTTPTKIFSSLSLAE 126 Query: 399 EG---GHVVDXXXXXXXXXXXXXXRRFYLHPSPRSRSRMVKPELLTLFPLTSPNSGQQ 563 G G RRFYLHPSPRS+ +PELLTLFPLTSP +G++ Sbjct: 127 RGSSRGEPAASELNTQEEEKAIRERRFYLHPSPRSKPGFNEPELLTLFPLTSPKTGEE 184 >ref|XP_023637489.1| VQ motif-containing protein 31 isoform X2 [Capsella rubella] Length = 144 Score = 56.2 bits (134), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 110 RRFYLHPSPRSKQGYTEPELLTLFPLTSPNS 140 >ref|XP_013629569.1| PREDICTED: VQ motif-containing protein 31 isoform X3 [Brassica oleracea var. oleracea] Length = 142 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 108 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 138 >ref|NP_001318511.1| VQ motif-containing protein [Arabidopsis thaliana] gb|AAM62784.1| unknown [Arabidopsis thaliana] gb|ABE66144.1| VQ motif-containing protein [Arabidopsis thaliana] gb|AED91308.1| VQ motif-containing protein [Arabidopsis thaliana] Length = 142 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 108 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 138 >ref|XP_023890141.1| VQ motif-containing protein 31-like [Quercus suber] ref|XP_023890142.1| VQ motif-containing protein 31-like [Quercus suber] ref|XP_023890143.1| VQ motif-containing protein 31-like [Quercus suber] Length = 180 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNSGQ 560 RRFYLHPSPRSR +PELLTLFPLTSP +G+ Sbjct: 146 RRFYLHPSPRSRPGYTEPELLTLFPLTSPKTGE 178 >ref|XP_024012159.1| VQ motif-containing protein 31 isoform X2 [Eutrema salsugineum] Length = 143 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 109 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 139 >ref|XP_018474518.1| PREDICTED: VQ motif-containing protein 31 isoform X3 [Raphanus sativus] Length = 143 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 109 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 139 >ref|XP_013629568.1| PREDICTED: VQ motif-containing protein 31 isoform X2 [Brassica oleracea var. oleracea] Length = 143 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 109 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 139 >ref|XP_018474517.1| PREDICTED: VQ motif-containing protein 31 isoform X2 [Raphanus sativus] Length = 151 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 117 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 147 >ref|XP_006290199.1| VQ motif-containing protein 31 isoform X1 [Capsella rubella] ref|XP_023637488.1| VQ motif-containing protein 31 isoform X1 [Capsella rubella] gb|EOA23097.1| hypothetical protein CARUB_v10003884mg [Capsella rubella] Length = 175 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 141 RRFYLHPSPRSKQGYTEPELLTLFPLTSPNS 171 >ref|NP_850793.1| VQ motif-containing protein [Arabidopsis thaliana] ref|NP_001330395.1| VQ motif-containing protein [Arabidopsis thaliana] sp|Q9FNP0.1|VQ31_ARATH RecName: Full=VQ motif-containing protein 31; Short=AtVQ31; AltName: Full=MPK3/6-targeted VQ-motif-containing protein 6 dbj|BAB09997.1| unnamed protein product [Arabidopsis thaliana] gb|ABE66143.1| VQ motif-containing protein [Arabidopsis thaliana] gb|ABG48456.1| At5g08480 [Arabidopsis thaliana] gb|AED91309.1| VQ motif-containing protein [Arabidopsis thaliana] gb|OAO90727.1| hypothetical protein AXX17_AT5G08350 [Arabidopsis thaliana] gb|ANM68666.1| VQ motif-containing protein [Arabidopsis thaliana] Length = 173 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 139 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 169 >ref|XP_018474516.1| PREDICTED: VQ motif-containing protein 31 isoform X1 [Raphanus sativus] Length = 174 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 140 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 170 >ref|XP_013609860.1| PREDICTED: VQ motif-containing protein 31-like isoform X2 [Brassica oleracea var. oleracea] ref|XP_013702269.1| VQ motif-containing protein 31-like [Brassica napus] ref|XP_022566129.1| VQ motif-containing protein 31-like [Brassica napus] Length = 174 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 140 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 170 >ref|XP_013629567.1| PREDICTED: VQ motif-containing protein 31 isoform X1 [Brassica oleracea var. oleracea] Length = 174 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 140 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 170 >ref|XP_009122454.1| PREDICTED: VQ motif-containing protein 31 isoform X2 [Brassica rapa] ref|XP_022549471.1| VQ motif-containing protein 31-like isoform X3 [Brassica napus] Length = 174 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 140 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 170 >ref|XP_006399346.1| VQ motif-containing protein 31 isoform X1 [Eutrema salsugineum] ref|XP_024012158.1| VQ motif-containing protein 31 isoform X1 [Eutrema salsugineum] gb|ESQ40799.1| hypothetical protein EUTSA_v10015866mg [Eutrema salsugineum] Length = 174 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 140 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 170 >gb|ABK28690.1| unknown, partial [Arabidopsis thaliana] Length = 174 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 139 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 169 >ref|XP_022549470.1| VQ motif-containing protein 31-like isoform X2 [Brassica napus] Length = 175 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +3 Query: 462 RRFYLHPSPRSRSRMVKPELLTLFPLTSPNS 554 RRFYLHPSPRS+ +PELLTLFPLTSPNS Sbjct: 141 RRFYLHPSPRSKPGYTEPELLTLFPLTSPNS 171