BLASTX nr result
ID: Cheilocostus21_contig00051769
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00051769 (970 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001168686.1| putative protein kinase superfamily protein ... 67 2e-08 ref|NP_001150204.1| protein kinase APK1B [Zea mays] >gi|19563754... 67 2e-08 ref|XP_002438802.1| probable serine/threonine-protein kinase PBL... 67 2e-08 gb|AQL05220.1| Protein kinase superfamily protein [Zea mays] 67 2e-08 ref|XP_004965638.1| probable serine/threonine-protein kinase PBL... 67 2e-08 ref|XP_015644179.1| PREDICTED: serine/threonine-protein kinase A... 67 2e-08 gb|EAZ01978.1| hypothetical protein OsI_24012 [Oryza sativa Indi... 67 2e-08 gb|PAN22929.1| hypothetical protein PAHAL_D00603 [Panicum hallii] 67 2e-08 ref|XP_006656337.1| PREDICTED: serine/threonine-protein kinase A... 67 2e-08 ref|XP_003563358.1| PREDICTED: serine/threonine-protein kinase A... 67 2e-08 ref|XP_020151102.1| probable serine/threonine-protein kinase PBL... 67 2e-08 gb|AQK81627.1| Protein kinase superfamily protein [Zea mays] >gi... 67 2e-08 dbj|BAK03343.1| predicted protein [Hordeum vulgare subsp. vulgare] 67 2e-08 gb|OEL23297.1| Serine/threonine-protein kinase [Dichanthelium ol... 67 2e-08 ref|XP_020684596.1| probable serine/threonine-protein kinase PBL... 65 7e-08 ref|XP_020582746.1| probable serine/threonine-protein kinase PBL... 65 7e-08 gb|OAY77534.1| Serine/threonine-protein kinase [Ananas comosus] 64 1e-07 gb|OAY78405.1| Serine/threonine-protein kinase [Ananas comosus] 64 1e-07 ref|XP_010245739.1| PREDICTED: serine/threonine-protein kinase A... 62 5e-07 ref|XP_010245738.1| PREDICTED: serine/threonine-protein kinase A... 62 6e-07 >ref|NP_001168686.1| putative protein kinase superfamily protein [Zea mays] gb|ACN29194.1| unknown [Zea mays] gb|AQL05221.1| Protein kinase superfamily protein [Zea mays] gb|AQL05222.1| Protein kinase superfamily protein [Zea mays] gb|AQL05223.1| Protein kinase superfamily protein [Zea mays] Length = 465 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >ref|NP_001150204.1| protein kinase APK1B [Zea mays] gb|ACG38242.1| protein kinase APK1B [Zea mays] gb|AQK81625.1| Protein kinase superfamily protein [Zea mays] Length = 465 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >ref|XP_002438802.1| probable serine/threonine-protein kinase PBL17 [Sorghum bicolor] gb|KXG20556.2| hypothetical protein SORBI_3010G219100 [Sorghum bicolor] Length = 466 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >gb|AQL05220.1| Protein kinase superfamily protein [Zea mays] Length = 467 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >ref|XP_004965638.1| probable serine/threonine-protein kinase PBL17 [Setaria italica] gb|KQL11063.1| hypothetical protein SETIT_006368mg [Setaria italica] Length = 467 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >ref|XP_015644179.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Oryza sativa Japonica Group] dbj|BAD45867.1| putative protein kinase [Oryza sativa Japonica Group] dbj|BAF20203.1| Os06g0663200 [Oryza sativa Japonica Group] gb|EAZ37906.1| hypothetical protein OsJ_22256 [Oryza sativa Japonica Group] dbj|BAS99007.1| Os06g0663200 [Oryza sativa Japonica Group] Length = 469 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 138 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 169 >gb|EAZ01978.1| hypothetical protein OsI_24012 [Oryza sativa Indica Group] Length = 469 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 138 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 169 >gb|PAN22929.1| hypothetical protein PAHAL_D00603 [Panicum hallii] Length = 471 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >ref|XP_006656337.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Oryza brachyantha] Length = 471 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 138 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 169 >ref|XP_003563358.1| PREDICTED: serine/threonine-protein kinase At5g01020 [Brachypodium distachyon] gb|KQK16981.1| hypothetical protein BRADI_1g31750v3 [Brachypodium distachyon] Length = 473 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 142 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 173 >ref|XP_020151102.1| probable serine/threonine-protein kinase PBL17 [Aegilops tauschii subsp. tauschii] Length = 477 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 142 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 173 >gb|AQK81627.1| Protein kinase superfamily protein [Zea mays] gb|AQK81628.1| Protein kinase superfamily protein [Zea mays] Length = 491 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >dbj|BAK03343.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 892 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 142 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 173 >gb|OEL23297.1| Serine/threonine-protein kinase [Dichanthelium oligosanthes] Length = 962 Score = 66.6 bits (161), Expect = 2e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRRKWLN 98 GYCCEG HRLLVYEYMACGSLEKHLFRR LN Sbjct: 139 GYCCEGSHRLLVYEYMACGSLEKHLFRRVCLN 170 >ref|XP_020684596.1| probable serine/threonine-protein kinase PBL17 [Dendrobium catenatum] gb|PKU69532.1| Serine/threonine-protein kinase [Dendrobium catenatum] Length = 440 Score = 64.7 bits (156), Expect = 7e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRR 86 GYCCEG HRLLVYEYMACGSLEKHLFRR Sbjct: 141 GYCCEGEHRLLVYEYMACGSLEKHLFRR 168 >ref|XP_020582746.1| probable serine/threonine-protein kinase PBL17 [Phalaenopsis equestris] Length = 443 Score = 64.7 bits (156), Expect = 7e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRR 86 GYCCEG HRLLVYEYMACGSLEKHLFRR Sbjct: 145 GYCCEGEHRLLVYEYMACGSLEKHLFRR 172 >gb|OAY77534.1| Serine/threonine-protein kinase [Ananas comosus] Length = 485 Score = 63.9 bits (154), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRR 86 GYCCEG HRLLVYEYMACGSLEKHLFRR Sbjct: 141 GYCCEGTHRLLVYEYMACGSLEKHLFRR 168 >gb|OAY78405.1| Serine/threonine-protein kinase [Ananas comosus] Length = 492 Score = 63.9 bits (154), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRR 86 GYCCEG HRLLVYEYMACGSLEKHLFRR Sbjct: 141 GYCCEGTHRLLVYEYMACGSLEKHLFRR 168 >ref|XP_010245739.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform X3 [Nelumbo nucifera] Length = 398 Score = 62.0 bits (149), Expect = 5e-07 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRR 86 GYCCE HRLLVYEYMACGSLEKHLFRR Sbjct: 76 GYCCEDEHRLLVYEYMACGSLEKHLFRR 103 >ref|XP_010245738.1| PREDICTED: serine/threonine-protein kinase At5g01020 isoform X2 [Nelumbo nucifera] Length = 469 Score = 62.0 bits (149), Expect = 6e-07 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 GYCCEGHHRLLVYEYMACGSLEKHLFRR 86 GYCCE HRLLVYEYMACGSLEKHLFRR Sbjct: 147 GYCCEDEHRLLVYEYMACGSLEKHLFRR 174