BLASTX nr result
ID: Cheilocostus21_contig00051712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00051712 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018674396.1| PREDICTED: pentatricopeptide repeat-containi... 126 2e-30 ref|XP_009420709.1| PREDICTED: pentatricopeptide repeat-containi... 126 2e-30 ref|XP_008809472.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 116 6e-27 ref|XP_010908164.1| PREDICTED: pentatricopeptide repeat-containi... 115 2e-26 gb|OAY78852.1| Pentatricopeptide repeat-containing protein DOT4,... 107 1e-23 ref|XP_020091644.1| pentatricopeptide repeat-containing protein ... 107 1e-23 ref|XP_022879414.1| pentatricopeptide repeat-containing protein ... 90 1e-17 ref|XP_008226293.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-17 ref|XP_021832308.1| putative pentatricopeptide repeat-containing... 89 2e-17 gb|KVI09034.1| Pentatricopeptide repeat-containing protein [Cyna... 89 2e-17 gb|PIN21508.1| hypothetical protein CDL12_05778 [Handroanthus im... 89 2e-17 ref|XP_012852768.1| PREDICTED: pentatricopeptide repeat-containi... 89 3e-17 gb|OVA05194.1| Pentatricopeptide repeat [Macleaya cordata] 88 4e-17 ref|XP_017241718.1| PREDICTED: pentatricopeptide repeat-containi... 88 4e-17 ref|XP_018506254.1| PREDICTED: pentatricopeptide repeat-containi... 88 5e-17 gb|PIA52447.1| hypothetical protein AQUCO_01000371v1 [Aquilegia ... 88 5e-17 gb|PKU64727.1| Pentatricopeptide repeat-containing protein [Dend... 87 1e-16 ref|XP_020705679.1| putative pentatricopeptide repeat-containing... 87 1e-16 gb|OTG21085.1| putative tetratricopeptide-like helical domain, D... 86 2e-16 ref|XP_023729035.1| pentatricopeptide repeat-containing protein ... 86 2e-16 >ref|XP_018674396.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 684 Score = 126 bits (316), Expect = 2e-30 Identities = 59/86 (68%), Positives = 73/86 (84%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M HK P+++LPP+V+L+FL YL SG L+RARDLFD+IPHPDLRSLTIL+SA+T+ NLP Sbjct: 1 MVHKFPVVDLPPNVTLRFLRSYLSSGQLERARDLFDRIPHPDLRSLTILISAFTKNNLPK 60 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E IR YR LR +K ++PDRLVLLSVA Sbjct: 61 ESIRFYRTLRENKGLEPDRLVLLSVA 86 >ref|XP_009420709.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 692 Score = 126 bits (316), Expect = 2e-30 Identities = 59/86 (68%), Positives = 73/86 (84%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M HK P+++LPP+V+L+FL YL SG L+RARDLFD+IPHPDLRSLTIL+SA+T+ NLP Sbjct: 1 MVHKFPVVDLPPNVTLRFLRSYLSSGQLERARDLFDRIPHPDLRSLTILISAFTKNNLPK 60 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E IR YR LR +K ++PDRLVLLSVA Sbjct: 61 ESIRFYRTLRENKGLEPDRLVLLSVA 86 >ref|XP_008809472.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g04780-like [Phoenix dactylifera] Length = 691 Score = 116 bits (290), Expect = 6e-27 Identities = 59/86 (68%), Positives = 69/86 (80%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M LPI NLPP +S+ FL YL +G LDRAR+LFDKIPHPDLRSLT+L+SAYT+Q P Sbjct: 1 MPPTLPI-NLPPHLSINFLRSYLSAGRLDRARELFDKIPHPDLRSLTVLISAYTKQGHPK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E I LY +LR+ KD+KPDRLVLLSVA Sbjct: 60 ESISLYWKLRSEKDLKPDRLVLLSVA 85 >ref|XP_010908164.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Elaeis guineensis] Length = 691 Score = 115 bits (287), Expect = 2e-26 Identities = 58/86 (67%), Positives = 68/86 (79%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 MT KLPI +LPP +S+ FL YL +G LDRAR+LFDKIPHPDLRSLT+L+ YT+Q L Sbjct: 1 MTPKLPI-HLPPHLSINFLKSYLNAGQLDRARELFDKIPHPDLRSLTVLICGYTKQGLSK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E I LY +LR KD+KPDRLVLLSVA Sbjct: 60 ESISLYWKLRREKDLKPDRLVLLSVA 85 >gb|OAY78852.1| Pentatricopeptide repeat-containing protein DOT4, chloroplastic [Ananas comosus] Length = 675 Score = 107 bits (266), Expect = 1e-23 Identities = 54/85 (63%), Positives = 65/85 (76%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M KL I N+PP+V LKF+ YL SG LDRARDLFD+IP PDLRSLT+L +AYT+Q P Sbjct: 1 MLQKLSI-NIPPNVILKFIKSYLISGELDRARDLFDRIPKPDLRSLTMLFTAYTKQGRPK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSV 506 E + LYRRLR+ I PD+LVLLS+ Sbjct: 60 ESVNLYRRLRSENRIDPDKLVLLSI 84 >ref|XP_020091644.1| pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Ananas comosus] Length = 691 Score = 107 bits (266), Expect = 1e-23 Identities = 54/85 (63%), Positives = 65/85 (76%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M KL I N+PP+V LKF+ YL SG LDRARDLFD+IP PDLRSLT+L +AYT+Q P Sbjct: 1 MLQKLSI-NIPPNVILKFIKSYLISGELDRARDLFDRIPKPDLRSLTMLFTAYTKQGRPK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSV 506 E + LYRRLR+ I PD+LVLLS+ Sbjct: 60 ESVNLYRRLRSENRIDPDKLVLLSI 84 >ref|XP_022879414.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] ref|XP_022879415.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] ref|XP_022879416.1| pentatricopeptide repeat-containing protein At1g20230-like [Olea europaea var. sylvestris] Length = 687 Score = 89.7 bits (221), Expect = 1e-17 Identities = 45/86 (52%), Positives = 58/86 (67%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M K+P NLPP +++KF+ YL SG L RAR LFDKI PD++ T+L++AYTRQ P Sbjct: 1 MISKIPT-NLPPHLNIKFIKNYLNSGDLKRARQLFDKISEPDIQLWTLLITAYTRQGHPK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E I+LY R + PD+L LLSVA Sbjct: 60 EAIKLYAEFRNRGKVNPDKLALLSVA 85 >ref|XP_008226293.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Prunus mume] Length = 686 Score = 89.4 bits (220), Expect = 2e-17 Identities = 48/86 (55%), Positives = 59/86 (68%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M KLP N+P +SL+FL Y SG L RAR LFD+IPHPDLR+ T+L+S +TR P Sbjct: 1 MLSKLPA-NVPSHLSLRFLKIYCNSGDLQRARHLFDQIPHPDLRAWTVLISGHTRHGFPK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E I+LY LR + I PD L+LLSVA Sbjct: 60 ESIKLYTSLR-GRHIVPDNLLLLSVA 84 >ref|XP_021832308.1| putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Prunus avium] Length = 686 Score = 89.0 bits (219), Expect = 2e-17 Identities = 48/86 (55%), Positives = 59/86 (68%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M KLP N+P +SL+FL Y SG L RAR LFD+IPHPDLR+ T+L+S +TR P Sbjct: 1 MLSKLPA-NVPSHLSLRFLKIYCNSGDLQRARRLFDQIPHPDLRAWTVLISGHTRHGFPK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E I+LY LR + I PD L+LLSVA Sbjct: 60 ESIKLYTSLR-GRHIVPDNLLLLSVA 84 >gb|KVI09034.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 686 Score = 89.0 bits (219), Expect = 2e-17 Identities = 49/85 (57%), Positives = 61/85 (71%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M KLP NLPP +SLKF+ Y SG L RAR LFDKI +PD+ S T+L+SAYTR+ L Sbjct: 1 MLPKLPS-NLPPHLSLKFIKSYCDSGDLRRARQLFDKITNPDVYSWTVLISAYTRRGLQK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSV 506 E I LY +LR ++I+PD+ VLLSV Sbjct: 60 EAINLYTQLR-DREIQPDKFVLLSV 83 >gb|PIN21508.1| hypothetical protein CDL12_05778 [Handroanthus impetiginosus] Length = 687 Score = 89.0 bits (219), Expect = 2e-17 Identities = 44/86 (51%), Positives = 61/86 (70%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M K+P NLPP +++KF+ YL SG + RAR LFD I PD++S T+L+SAYTR L N Sbjct: 1 MLSKVPT-NLPPHLNIKFIRKYLNSGDIARARQLFDVISEPDVQSWTLLISAYTRNGLCN 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E + LY ++ SK IKPD+L +L+V+ Sbjct: 60 EAVNLYTEVKKSKTIKPDKLAILAVS 85 >ref|XP_012852768.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Erythranthe guttata] gb|EYU44325.1| hypothetical protein MIMGU_mgv1a002336mg [Erythranthe guttata] Length = 687 Score = 88.6 bits (218), Expect = 3e-17 Identities = 45/86 (52%), Positives = 59/86 (68%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M K+P NLPP +++ F+ YL SG L RAR LFD I HPD++S T+L+SAYTR Sbjct: 1 MLSKVPT-NLPPHLNINFIKKYLNSGDLARARQLFDGISHPDVQSWTLLISAYTRSGRCR 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E I+LY LR S+ I PD+ V+L+VA Sbjct: 60 EAIKLYTELRNSRKINPDKFVILAVA 85 >gb|OVA05194.1| Pentatricopeptide repeat [Macleaya cordata] Length = 686 Score = 88.2 bits (217), Expect = 4e-17 Identities = 46/78 (58%), Positives = 57/78 (73%) Frame = +3 Query: 276 NLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPNECIRLYRR 455 NLP +SLKFL Y SG ++ AR +FDKIP PDL S TIL+SA+T Q P E I LY+ Sbjct: 8 NLPSHLSLKFLKIYANSGDIESARRVFDKIPQPDLPSWTILISAHTNQGFPKESIELYKD 67 Query: 456 LRTSKDIKPDRLVLLSVA 509 LR ++I+PD+LVLLSVA Sbjct: 68 LR-KRNIEPDKLVLLSVA 84 >ref|XP_017241718.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Daucus carota subsp. sativus] gb|KZN02195.1| hypothetical protein DCAR_010949 [Daucus carota subsp. sativus] Length = 691 Score = 88.2 bits (217), Expect = 4e-17 Identities = 47/82 (57%), Positives = 59/82 (71%) Frame = +3 Query: 261 KLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPNECI 440 KLP NLPP +SLKF+ YL SG L RAR LFDKI PD+ S T+L++AYT+Q E + Sbjct: 9 KLPT-NLPPHLSLKFIKIYLNSGDLLRARQLFDKILQPDIHSCTVLINAYTKQGHAKEAL 67 Query: 441 RLYRRLRTSKDIKPDRLVLLSV 506 LY LR ++DI+PD+L LLSV Sbjct: 68 NLYSELR-ARDIQPDKLALLSV 88 >ref|XP_018506254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Pyrus x bretschneideri] Length = 686 Score = 87.8 bits (216), Expect = 5e-17 Identities = 47/86 (54%), Positives = 59/86 (68%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M KLP N+PP +SL+FL + SG L RAR LFD+IP PDLR+ T+L+S YTR LP Sbjct: 1 MLSKLPT-NVPPHLSLRFLKIFCNSGDLQRARHLFDQIPEPDLRAWTLLISGYTRHGLPK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSVA 509 E + LY LR ++ I PD +LLSVA Sbjct: 60 ESVSLYASLR-ARRIAPDSFLLLSVA 84 >gb|PIA52447.1| hypothetical protein AQUCO_01000371v1 [Aquilegia coerulea] Length = 687 Score = 87.8 bits (216), Expect = 5e-17 Identities = 43/77 (55%), Positives = 56/77 (72%) Frame = +3 Query: 276 NLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPNECIRLYRR 455 NLP ++ KFL YL +G L+ AR LFDKIP PDL++ TIL++AYT+Q P E I+LY + Sbjct: 8 NLPANLCQKFLKTYLNTGDLESARHLFDKIPQPDLKTWTILVTAYTKQGYPEESIKLYTK 67 Query: 456 LRTSKDIKPDRLVLLSV 506 LR +I+ D LVLLSV Sbjct: 68 LRQKNNIRVDSLVLLSV 84 >gb|PKU64727.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 673 Score = 86.7 bits (213), Expect = 1e-16 Identities = 42/71 (59%), Positives = 54/71 (76%) Frame = +3 Query: 297 LKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPNECIRLYRRLRTSKDI 476 +K L YL SG LD AR LFDKIP+PDLR+LT+LLSAY++ P + I LYR+L K++ Sbjct: 1 MKSLSSYLHSGQLDLARKLFDKIPNPDLRALTLLLSAYSKHGRPKQSIALYRKLCKEKNL 60 Query: 477 KPDRLVLLSVA 509 +PDR V+LSVA Sbjct: 61 QPDRYVILSVA 71 >ref|XP_020705679.1| putative pentatricopeptide repeat-containing protein At3g13770, mitochondrial [Dendrobium catenatum] Length = 758 Score = 86.7 bits (213), Expect = 1e-16 Identities = 42/71 (59%), Positives = 54/71 (76%) Frame = +3 Query: 297 LKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPNECIRLYRRLRTSKDI 476 +K L YL SG LD AR LFDKIP+PDLR+LT+LLSAY++ P + I LYR+L K++ Sbjct: 1 MKSLSSYLHSGQLDLARKLFDKIPNPDLRALTLLLSAYSKHGRPKQSIALYRKLCKEKNL 60 Query: 477 KPDRLVLLSVA 509 +PDR V+LSVA Sbjct: 61 QPDRYVILSVA 71 >gb|OTG21085.1| putative tetratricopeptide-like helical domain, DYW domain protein [Helianthus annuus] Length = 629 Score = 85.9 bits (211), Expect = 2e-16 Identities = 46/84 (54%), Positives = 57/84 (67%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M +LP NLP +S K + Y SG L RA LFDK+P PDLRS T+L+SAYTR+ N Sbjct: 1 MLPRLPS-NLPAQLSFKLIKTYCESGDLTRAHQLFDKMPDPDLRSWTVLISAYTRRGCAN 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLS 503 E I LY RLR ++I+PD+ VLLS Sbjct: 60 EAINLYTRLR-DREIQPDKFVLLS 82 >ref|XP_023729035.1| pentatricopeptide repeat-containing protein At1g20230-like [Lactuca sativa] gb|PLY77616.1| hypothetical protein LSAT_2X87200 [Lactuca sativa] Length = 686 Score = 85.9 bits (211), Expect = 2e-16 Identities = 51/85 (60%), Positives = 56/85 (65%) Frame = +3 Query: 252 MTHKLPILNLPPSVSLKFLDCYLRSGHLDRARDLFDKIPHPDLRSLTILLSAYTRQNLPN 431 M KLPI NLPP +SLK + Y SG L RAR LFDKI PDL S T L+SAYTR +L Sbjct: 1 MLPKLPI-NLPPHLSLKLIKNYCDSGDLRRARQLFDKITSPDLHSWTTLISAYTRHDLQK 59 Query: 432 ECIRLYRRLRTSKDIKPDRLVLLSV 506 E I LY RLR +PDR VLLSV Sbjct: 60 EAINLYTRLR-DIGFQPDRFVLLSV 83