BLASTX nr result
ID: Cheilocostus21_contig00051697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00051697 (618 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009401589.1| PREDICTED: DUF21 domain-containing protein A... 63 4e-08 ref|XP_010942481.1| PREDICTED: DUF21 domain-containing protein A... 61 3e-07 ref|XP_010938761.1| PREDICTED: DUF21 domain-containing protein A... 59 2e-06 ref|XP_008776439.1| PREDICTED: DUF21 domain-containing protein A... 59 2e-06 ref|XP_008776436.1| PREDICTED: DUF21 domain-containing protein A... 59 2e-06 ref|XP_020267100.1| DUF21 domain-containing protein At4g14240-li... 58 3e-06 gb|ONK68002.1| uncharacterized protein A4U43_C05F6170 [Asparagus... 58 3e-06 >ref|XP_009401589.1| PREDICTED: DUF21 domain-containing protein At4g14240 [Musa acuminata subsp. malaccensis] Length = 523 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = +3 Query: 237 GALNRQGQ-PSGILKKSTEVDLHTPRHQVSLVEPLLGTQR 353 GALNRQGQ P+GILKK TE DLHT RHQV+LVEP+ GT+R Sbjct: 484 GALNRQGQQPTGILKKPTEADLHTSRHQVNLVEPISGTKR 523 >ref|XP_010942481.1| PREDICTED: DUF21 domain-containing protein At4g14240-like [Elaeis guineensis] Length = 525 Score = 60.8 bits (146), Expect = 3e-07 Identities = 31/40 (77%), Positives = 35/40 (87%), Gaps = 1/40 (2%) Frame = +3 Query: 237 GALNRQGQ-PSGILKKSTEVDLHTPRHQVSLVEPLLGTQR 353 GALNRQGQ PSGILKK TE + +TPRHQVSLVEP LG++R Sbjct: 486 GALNRQGQQPSGILKKPTEGESNTPRHQVSLVEPFLGSKR 525 >ref|XP_010938761.1| PREDICTED: DUF21 domain-containing protein At4g14240 [Elaeis guineensis] Length = 519 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +3 Query: 237 GALNRQGQ-PSGILKKSTEVDLHTPRHQVSLVEPLLGTQR 353 GA NRQGQ PSGILKK TE + +TPRHQV+LVEPLLG +R Sbjct: 480 GAQNRQGQQPSGILKKPTEGESNTPRHQVNLVEPLLGNKR 519 >ref|XP_008776439.1| PREDICTED: DUF21 domain-containing protein At4g14240-like isoform X2 [Phoenix dactylifera] ref|XP_008776440.1| PREDICTED: DUF21 domain-containing protein At4g14240-like isoform X2 [Phoenix dactylifera] Length = 524 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +3 Query: 237 GALNRQGQ-PSGILKKSTEVDLHTPRHQVSLVEPLLGTQR 353 GA NRQGQ PSGILKK TE + +TPRHQV+LVEPLLG +R Sbjct: 485 GAQNRQGQQPSGILKKPTEGESNTPRHQVNLVEPLLGNKR 524 >ref|XP_008776436.1| PREDICTED: DUF21 domain-containing protein At4g14240-like isoform X1 [Phoenix dactylifera] ref|XP_008776437.1| PREDICTED: DUF21 domain-containing protein At4g14240-like isoform X1 [Phoenix dactylifera] Length = 524 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = +3 Query: 237 GALNRQGQ-PSGILKKSTEVDLHTPRHQVSLVEPLLGTQR 353 GA NRQGQ PSGILKK TE + +TPRHQV+LVEPLLG +R Sbjct: 485 GAQNRQGQQPSGILKKPTEGESNTPRHQVNLVEPLLGNKR 524 >ref|XP_020267100.1| DUF21 domain-containing protein At4g14240-like [Asparagus officinalis] Length = 456 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 237 GALNRQGQPSGILKKSTEVDLHTPRHQVSLVEPLLGTQ 350 GA NRQGQP+GILKK TE D+ TPR+QV+L EPLLG + Sbjct: 419 GAQNRQGQPAGILKKPTEGDVKTPRNQVTLTEPLLGNK 456 >gb|ONK68002.1| uncharacterized protein A4U43_C05F6170 [Asparagus officinalis] Length = 511 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 237 GALNRQGQPSGILKKSTEVDLHTPRHQVSLVEPLLGTQ 350 GA NRQGQP+GILKK TE D+ TPR+QV+L EPLLG + Sbjct: 474 GAQNRQGQPAGILKKPTEGDVKTPRNQVTLTEPLLGNK 511