BLASTX nr result
ID: Cheilocostus21_contig00051500
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00051500 (519 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018823092.1| PREDICTED: potassium transporter 8-like [Jug... 46 8e-07 ref|XP_018828751.1| PREDICTED: potassium transporter 8-like [Jug... 45 1e-06 gb|KMZ69039.1| putative Potassium transporter [Zostera marina] 44 4e-06 ref|XP_023922920.1| potassium transporter 8-like [Quercus suber] 44 4e-06 gb|POE97496.1| potassium transporter 8 [Quercus suber] 44 4e-06 ref|XP_020109237.1| potassium transporter 10-like [Ananas comosus] 43 5e-06 emb|CDP02133.1| unnamed protein product [Coffea canephora] 44 5e-06 ref|XP_006844251.1| potassium transporter 6 [Amborella trichopod... 43 7e-06 gb|PPS05914.1| hypothetical protein GOBAR_AA14733 [Gossypium bar... 45 9e-06 ref|XP_022887575.1| potassium transporter 6-like isoform X1 [Ole... 42 9e-06 ref|XP_022887579.1| potassium transporter 6-like isoform X2 [Ole... 42 9e-06 gb|PPS18023.1| hypothetical protein GOBAR_AA02564 [Gossypium bar... 42 9e-06 gb|PPD92239.1| hypothetical protein GOBAR_DD10833 [Gossypium bar... 42 9e-06 ref|XP_017646834.1| PREDICTED: potassium transporter 8-like [Gos... 42 9e-06 ref|XP_016672819.1| PREDICTED: potassium transporter 8-like [Gos... 42 9e-06 ref|XP_012483782.1| PREDICTED: potassium transporter 8-like [Gos... 42 9e-06 gb|ADF36482.1| high-affinity potassium transporter protein 2, pa... 42 9e-06 >ref|XP_018823092.1| PREDICTED: potassium transporter 8-like [Juglans regia] Length = 774 Score = 45.8 bits (107), Expect(2) = 8e-07 Identities = 29/61 (47%), Positives = 35/61 (57%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKSVLVLLEM 295 L + GSEAMFADLGHFSQLSIK+ TC+ VY L + Y Y S ++E Sbjct: 277 LCITGSEAMFADLGHFSQLSIKIA-------FTCM-VYPSLILAYMGQAAYLSKHHVIES 328 Query: 296 H 298 H Sbjct: 329 H 329 Score = 34.7 bits (78), Expect(2) = 8e-07 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 269 WMSLGGILLCITGSE 283 >ref|XP_018828751.1| PREDICTED: potassium transporter 8-like [Juglans regia] ref|XP_018828752.1| PREDICTED: potassium transporter 8-like [Juglans regia] Length = 774 Score = 45.1 bits (105), Expect(2) = 1e-06 Identities = 29/61 (47%), Positives = 34/61 (55%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKSVLVLLEM 295 L + GSEAMFADLGHFSQLSIK+ TC+ VY L + Y Y S +E Sbjct: 277 LCITGSEAMFADLGHFSQLSIKIA-------FTCM-VYPSLILAYMGQAAYLSKHHAIES 328 Query: 296 H 298 H Sbjct: 329 H 329 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 269 WMSLGGILLCITGSE 283 >gb|KMZ69039.1| putative Potassium transporter [Zostera marina] Length = 790 Score = 43.9 bits (102), Expect(2) = 4e-06 Identities = 29/61 (47%), Positives = 34/61 (55%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKSVLVLLEM 295 L + GSEAMFADLGHFSQLSIK+ +CV VY L + Y Y S L+ Sbjct: 299 LCVTGSEAMFADLGHFSQLSIKIA-------FSCV-VYPSLILAYMGQAAYLSKHHLIAK 350 Query: 296 H 298 H Sbjct: 351 H 351 Score = 34.3 bits (77), Expect(2) = 4e-06 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLC+TG+E Sbjct: 291 WMSLGGILLCVTGSE 305 >ref|XP_023922920.1| potassium transporter 8-like [Quercus suber] Length = 776 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 27/53 (50%), Positives = 31/53 (58%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKS 274 L + GSEAMFADLGHFSQLSIK+ TC+ VY L + Y Y S Sbjct: 277 LCITGSEAMFADLGHFSQLSIKIA-------FTCI-VYPSLILAYMGQAAYIS 321 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 269 WMSLGGILLCITGSE 283 >gb|POE97496.1| potassium transporter 8 [Quercus suber] Length = 746 Score = 43.5 bits (101), Expect(2) = 4e-06 Identities = 27/53 (50%), Positives = 31/53 (58%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKS 274 L + GSEAMFADLGHFSQLSIK+ TC+ VY L + Y Y S Sbjct: 247 LCITGSEAMFADLGHFSQLSIKIA-------FTCI-VYPSLILAYMGQAAYIS 291 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 239 WMSLGGILLCITGSE 253 >ref|XP_020109237.1| potassium transporter 10-like [Ananas comosus] Length = 794 Score = 43.1 bits (100), Expect(2) = 5e-06 Identities = 27/61 (44%), Positives = 32/61 (52%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKSVLVLLEM 295 L + GSEAMFADLGHFSQLSIK+ VY L + Y Y S ++E Sbjct: 297 LCITGSEAMFADLGHFSQLSIKI--------AFTFVVYPSLILAYMGQAAYLSKHHVIES 348 Query: 296 H 298 H Sbjct: 349 H 349 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 289 WMSLGGILLCITGSE 303 >emb|CDP02133.1| unnamed protein product [Coffea canephora] Length = 745 Score = 44.3 bits (103), Expect(2) = 5e-06 Identities = 29/59 (49%), Positives = 34/59 (57%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKSVLVLLE 292 L + GSEAM+ADLGHFSQLSIK+ TCV VY L + Y Y S L+E Sbjct: 278 LCMTGSEAMYADLGHFSQLSIKIA-------FTCV-VYPALILAYMGQAAYLSKHHLIE 328 Score = 33.5 bits (75), Expect(2) = 5e-06 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLC+TG+E Sbjct: 270 WMSLGGILLCMTGSE 284 >ref|XP_006844251.1| potassium transporter 6 [Amborella trichopoda] gb|ERN05926.1| hypothetical protein AMTR_s00006p00269170 [Amborella trichopoda] Length = 775 Score = 42.7 bits (99), Expect(2) = 7e-06 Identities = 26/61 (42%), Positives = 33/61 (54%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKSVLVLLEM 295 L + GSEAMFADLGHFSQLSI++ VY L + Y Y S+ ++E Sbjct: 275 LCITGSEAMFADLGHFSQLSIQI--------AFTFVVYPSLILAYMGQAAYLSMHHVIES 326 Query: 296 H 298 H Sbjct: 327 H 327 Score = 34.7 bits (78), Expect(2) = 7e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 267 WMSLGGILLCITGSE 281 >gb|PPS05914.1| hypothetical protein GOBAR_AA14733 [Gossypium barbadense] Length = 815 Score = 44.7 bits (104), Expect(2) = 9e-06 Identities = 21/41 (51%), Positives = 30/41 (73%) Frame = +2 Query: 62 IISAFYCVPHPHVAFCSFLLLPGSEAMFADLGHFSQLSIKV 184 ++S + H++ + L++ GSEAMFADLGHFSQLSIK+ Sbjct: 299 LVSKYVSNTGSHMSTNADLIVSGSEAMFADLGHFSQLSIKI 339 Score = 32.3 bits (72), Expect(2) = 9e-06 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 1 WMSLGGILLCITG 39 WMSLGGILLCITG Sbjct: 271 WMSLGGILLCITG 283 >ref|XP_022887575.1| potassium transporter 6-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022887576.1| potassium transporter 6-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022887577.1| potassium transporter 6-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022887578.1| potassium transporter 6-like isoform X1 [Olea europaea var. sylvestris] Length = 780 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 27/53 (50%), Positives = 30/53 (56%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKS 274 L + GSEAMFADLGHFSQLSIK+ F T VY L + Y Y S Sbjct: 277 LCITGSEAMFADLGHFSQLSIKI------AFTTI--VYPSLILAYMGQAAYLS 321 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 269 WMSLGGILLCITGSE 283 >ref|XP_022887579.1| potassium transporter 6-like isoform X2 [Olea europaea var. sylvestris] Length = 765 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 27/53 (50%), Positives = 30/53 (56%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKVRDGDGKCFRTCVKVYSRLYMMYSAP*LYKS 274 L + GSEAMFADLGHFSQLSIK+ F T VY L + Y Y S Sbjct: 277 LCITGSEAMFADLGHFSQLSIKI------AFTTI--VYPSLILAYMGQAAYLS 321 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 269 WMSLGGILLCITGSE 283 >gb|PPS18023.1| hypothetical protein GOBAR_AA02564 [Gossypium barbadense] Length = 764 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKV 184 L + GSEAMFADLGHFSQLSIKV Sbjct: 272 LCITGSEAMFADLGHFSQLSIKV 294 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 264 WMSLGGILLCITGSE 278 >gb|PPD92239.1| hypothetical protein GOBAR_DD10833 [Gossypium barbadense] Length = 764 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKV 184 L + GSEAMFADLGHFSQLSIKV Sbjct: 272 LCITGSEAMFADLGHFSQLSIKV 294 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 264 WMSLGGILLCITGSE 278 >ref|XP_017646834.1| PREDICTED: potassium transporter 8-like [Gossypium arboreum] Length = 764 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKV 184 L + GSEAMFADLGHFSQLSIKV Sbjct: 272 LCITGSEAMFADLGHFSQLSIKV 294 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 264 WMSLGGILLCITGSE 278 >ref|XP_016672819.1| PREDICTED: potassium transporter 8-like [Gossypium hirsutum] Length = 764 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKV 184 L + GSEAMFADLGHFSQLSIKV Sbjct: 272 LCITGSEAMFADLGHFSQLSIKV 294 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 264 WMSLGGILLCITGSE 278 >ref|XP_012483782.1| PREDICTED: potassium transporter 8-like [Gossypium raimondii] gb|KJB33753.1| hypothetical protein B456_006G029100 [Gossypium raimondii] Length = 764 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKV 184 L + GSEAMFADLGHFSQLSIKV Sbjct: 272 LCITGSEAMFADLGHFSQLSIKV 294 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 264 WMSLGGILLCITGSE 278 >gb|ADF36482.1| high-affinity potassium transporter protein 2, partial [Gossypium hirsutum] Length = 764 Score = 42.4 bits (98), Expect(2) = 9e-06 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +2 Query: 116 LLLPGSEAMFADLGHFSQLSIKV 184 L + GSEAMFADLGHFSQLSIKV Sbjct: 272 LCITGSEAMFADLGHFSQLSIKV 294 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 1 WMSLGGILLCITGAE 45 WMSLGGILLCITG+E Sbjct: 264 WMSLGGILLCITGSE 278