BLASTX nr result
ID: Cheilocostus21_contig00051464
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00051464 (752 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010911594.1| PREDICTED: uncharacterized protein LOC105037... 57 2e-06 >ref|XP_010911594.1| PREDICTED: uncharacterized protein LOC105037651 [Elaeis guineensis] Length = 174 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +1 Query: 1 FRFKQDLIYLSSTFSAQGCNPGFNRVIYLLLSL 99 F+FKQDL+YLSSTFS+QGC+PGF+RV+ L LSL Sbjct: 130 FKFKQDLVYLSSTFSSQGCHPGFDRVLTLSLSL 162