BLASTX nr result
ID: Cheilocostus21_contig00051100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00051100 (584 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ATV81253.1| hypothetical protein [Grapevine badnavirus 1] 54 1e-05 >gb|ATV81253.1| hypothetical protein [Grapevine badnavirus 1] Length = 137 Score = 53.5 bits (127), Expect = 1e-05 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 211 TNSSFSKGTQSYREAIQATEHIESPPLGFARPSEYQGALVSCSSKATSSKQN 56 +N +S+GT +Y+EAI+ATE IESP LGF +PS+Y+G + S+ KQN Sbjct: 2 SNYLYSQGTVTYKEAIKATESIESPALGFVKPSDYKGGI---SAPTAQIKQN 50