BLASTX nr result
ID: Cheilocostus21_contig00050422
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00050422 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009399668.1| PREDICTED: cyclin-dependent kinase C-2 [Musa... 58 4e-07 gb|PIA33055.1| hypothetical protein AQUCO_04200066v1 [Aquilegia ... 56 1e-06 gb|ACS68789.1| cdc2 kinase, partial [Prunus incisa] 54 2e-06 gb|ONK75549.1| uncharacterized protein A4U43_C03F18060 [Asparagu... 56 2e-06 ref|XP_020528386.1| cyclin-dependent kinase C-2 isoform X5 [Ambo... 56 2e-06 gb|PIA52158.1| hypothetical protein AQUCO_01000202v1 [Aquilegia ... 56 2e-06 ref|XP_006853325.1| cyclin-dependent kinase C-2 isoform X4 [Ambo... 56 2e-06 ref|XP_020257424.1| LOW QUALITY PROTEIN: cyclin-dependent kinase... 56 2e-06 ref|XP_011626588.1| cyclin-dependent kinase C-2 isoform X3 [Ambo... 56 2e-06 ref|XP_020528385.1| cyclin-dependent kinase C-2 isoform X2 [Ambo... 56 2e-06 ref|XP_020528384.1| cyclin-dependent kinase C-2 isoform X1 [Ambo... 56 2e-06 gb|PON74958.1| GPCR kinase [Parasponia andersonii] 56 2e-06 gb|KJB25072.1| hypothetical protein B456_004G175700 [Gossypium r... 55 3e-06 gb|KVH57454.1| Protein kinase, catalytic domain-containing prote... 55 3e-06 gb|OUZ99342.1| Protein kinase domain [Macleaya cordata] 55 4e-06 ref|XP_020083429.1| cyclin-dependent kinase C-2 [Ananas comosus]... 55 4e-06 ref|XP_008790844.1| PREDICTED: cyclin-dependent kinase C-2-like ... 55 4e-06 ref|XP_017698521.1| PREDICTED: cyclin-dependent kinase C-2-like ... 55 4e-06 gb|OAY73302.1| Cyclin-dependent kinase C-2 [Ananas comosus] 55 4e-06 gb|PIA33056.1| hypothetical protein AQUCO_04200066v1 [Aquilegia ... 55 5e-06 >ref|XP_009399668.1| PREDICTED: cyclin-dependent kinase C-2 [Musa acuminata subsp. malaccensis] Length = 516 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRETFKHFDRHALELLERMLTLDPSQ Sbjct: 285 RVRETFKHFDRHALELLERMLTLDPSQ 311 >gb|PIA33055.1| hypothetical protein AQUCO_04200066v1 [Aquilegia coerulea] Length = 307 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQV 84 RVR+ FKHFDRHALELLERMLTLDPSQV Sbjct: 277 RVRDKFKHFDRHALELLERMLTLDPSQV 304 >gb|ACS68789.1| cdc2 kinase, partial [Prunus incisa] Length = 124 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 R+RE F+HFDRHALELLERMLTLDPSQ Sbjct: 63 RLREVFRHFDRHALELLERMLTLDPSQ 89 >gb|ONK75549.1| uncharacterized protein A4U43_C03F18060 [Asparagus officinalis] Length = 435 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 285 RVREVFKHFDRHALELLERMLTLDPSQ 311 >ref|XP_020528386.1| cyclin-dependent kinase C-2 isoform X5 [Amborella trichopoda] ref|XP_020528387.1| cyclin-dependent kinase C-2 isoform X5 [Amborella trichopoda] Length = 484 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 246 RVREVFKHFDRHALELLERMLTLDPSQ 272 >gb|PIA52158.1| hypothetical protein AQUCO_01000202v1 [Aquilegia coerulea] Length = 513 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 285 RVREVFKHFDRHALELLERMLTLDPSQ 311 >ref|XP_006853325.1| cyclin-dependent kinase C-2 isoform X4 [Amborella trichopoda] gb|ERN14792.1| hypothetical protein AMTR_s00032p00061960 [Amborella trichopoda] Length = 523 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 285 RVREVFKHFDRHALELLERMLTLDPSQ 311 >ref|XP_020257424.1| LOW QUALITY PROTEIN: cyclin-dependent kinase C-2-like [Asparagus officinalis] Length = 524 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 285 RVREVFKHFDRHALELLERMLTLDPSQ 311 >ref|XP_011626588.1| cyclin-dependent kinase C-2 isoform X3 [Amborella trichopoda] Length = 524 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 286 RVREVFKHFDRHALELLERMLTLDPSQ 312 >ref|XP_020528385.1| cyclin-dependent kinase C-2 isoform X2 [Amborella trichopoda] Length = 542 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 304 RVREVFKHFDRHALELLERMLTLDPSQ 330 >ref|XP_020528384.1| cyclin-dependent kinase C-2 isoform X1 [Amborella trichopoda] Length = 543 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLERMLTLDPSQ Sbjct: 305 RVREVFKHFDRHALELLERMLTLDPSQ 331 >gb|PON74958.1| GPCR kinase [Parasponia andersonii] Length = 317 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQVN 87 R+RE F+HFDRHALELLERMLTLDPSQV+ Sbjct: 285 RLREVFRHFDRHALELLERMLTLDPSQVS 313 >gb|KJB25072.1| hypothetical protein B456_004G175700 [Gossypium raimondii] Length = 349 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQV 84 R+RE F+HFDRHALELLERMLTLDPSQV Sbjct: 285 RLREVFRHFDRHALELLERMLTLDPSQV 312 >gb|KVH57454.1| Protein kinase, catalytic domain-containing protein [Cynara cardunculus var. scolymus] Length = 477 Score = 55.5 bits (132), Expect = 3e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQVNNLIVDDKVLDFIAFTI 135 R+RE F+HFDRHALELLE+MLTLDPSQV LI +VL ++ + Sbjct: 247 RLREVFRHFDRHALELLEKMLTLDPSQV-GLIEVSRVLSDLSLVL 290 >gb|OUZ99342.1| Protein kinase domain [Macleaya cordata] Length = 506 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHALELLE+MLTLDPSQ Sbjct: 280 RVREVFKHFDRHALELLEKMLTLDPSQ 306 >ref|XP_020083429.1| cyclin-dependent kinase C-2 [Ananas comosus] ref|XP_020083430.1| cyclin-dependent kinase C-2 [Ananas comosus] ref|XP_020083431.1| cyclin-dependent kinase C-2 [Ananas comosus] Length = 518 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHAL+LLERMLTLDPSQ Sbjct: 286 RVREVFKHFDRHALDLLERMLTLDPSQ 312 >ref|XP_008790844.1| PREDICTED: cyclin-dependent kinase C-2-like isoform X2 [Phoenix dactylifera] Length = 526 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 R+RE FKHFDRHALELLERMLTLDPSQ Sbjct: 285 RLREVFKHFDRHALELLERMLTLDPSQ 311 >ref|XP_017698521.1| PREDICTED: cyclin-dependent kinase C-2-like isoform X1 [Phoenix dactylifera] ref|XP_017698522.1| PREDICTED: cyclin-dependent kinase C-2-like isoform X1 [Phoenix dactylifera] Length = 538 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 R+RE FKHFDRHALELLERMLTLDPSQ Sbjct: 297 RLREVFKHFDRHALELLERMLTLDPSQ 323 >gb|OAY73302.1| Cyclin-dependent kinase C-2 [Ananas comosus] Length = 546 Score = 55.1 bits (131), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVRE FKHFDRHAL+LLERMLTLDPSQ Sbjct: 286 RVREVFKHFDRHALDLLERMLTLDPSQ 312 >gb|PIA33056.1| hypothetical protein AQUCO_04200066v1 [Aquilegia coerulea] Length = 357 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 RVRETFKHFDRHALELLERMLTLDPSQ 81 RVR+ FKHFDRHALELLERMLTLDPSQ Sbjct: 277 RVRDKFKHFDRHALELLERMLTLDPSQ 303