BLASTX nr result
ID: Cheilocostus21_contig00050396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00050396 (979 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400515.1| PREDICTED: protein MEMO1 homolog [Musa acumi... 43 2e-07 >ref|XP_009400515.1| PREDICTED: protein MEMO1 homolog [Musa acuminata subsp. malaccensis] Length = 291 Score = 42.7 bits (99), Expect(2) = 2e-07 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +1 Query: 772 HAGYSFSGHCIAFAFASTDPASI 840 HAGYS+SG C AFAFA+ DPASI Sbjct: 47 HAGYSYSGRCAAFAFANIDPASI 69 Score = 42.0 bits (97), Expect(2) = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 602 SAKKLD*ELDR*LQATFLLKSPSVRRVIAP*VG 700 +AKKLD ELDR LQA L+KSP+VR VIAP G Sbjct: 17 NAKKLDEELDRWLQAAGLVKSPNVRGVIAPHAG 49