BLASTX nr result
ID: Cheilocostus21_contig00050226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00050226 (642 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020083505.1| uncharacterized protein LOC109706898 [Ananas... 41 8e-07 >ref|XP_020083505.1| uncharacterized protein LOC109706898 [Ananas comosus] Length = 680 Score = 41.2 bits (95), Expect(2) = 8e-07 Identities = 16/34 (47%), Positives = 25/34 (73%) Frame = -1 Query: 102 LEIVDMANDFFLFKFETEEDALPVLTNGPWIVQG 1 L+I+D+ + FFLFKF +E+ L +L+ PW V+G Sbjct: 115 LDIIDLPSGFFLFKFSSEQAMLSILSASPWTVRG 148 Score = 40.0 bits (92), Expect(2) = 8e-07 Identities = 20/56 (35%), Positives = 34/56 (60%) Frame = -2 Query: 290 SSMISAAIIEKISNKYPKRVVFDKEKLVEWRQP*RCCLIGKFLIKPPPIHILRSII 123 ++ I+A + +I RVV D +L E + LIGKFL +PPP+HI+++++ Sbjct: 50 ANFITADQLSRIKAATTDRVVIDPIELQESINEWQFSLIGKFLTRPPPLHIIKNVL 105