BLASTX nr result
ID: Cheilocostus21_contig00050211
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00050211 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26510.1| hypothetical protein CDL12_00733 [Handroanthus im... 58 6e-07 >gb|PIN26510.1| hypothetical protein CDL12_00733 [Handroanthus impetiginosus] Length = 942 Score = 58.2 bits (139), Expect = 6e-07 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = -2 Query: 446 LCYFVVPHRFRNRIRLDVFVVADKLAEGLWVSLAQVALSNLFRTLREACTADSPSVKDTL 267 LC+FV+PHR NRIR VF VA +A G +LA L +++R LR+ T+ S + + Sbjct: 332 LCHFVLPHRRVNRIRATVFKVASMMARGDTFALAVPILVSIYRCLRDISTSASLNESTVI 391 Query: 266 IPLHYLF 246 P+HYL+ Sbjct: 392 FPIHYLY 398