BLASTX nr result
ID: Cheilocostus21_contig00050106
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00050106 (591 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_082197627.1| hypothetical protein [Enterococcus faecium] 56 5e-07 ref|WP_082195859.1| hypothetical protein [Enterococcus faecium] 53 3e-06 ref|WP_073470585.1| hypothetical protein [Enterococcus faecium] 53 3e-06 ref|WP_072539064.1| hypothetical protein [Enterococcus faecium] 54 3e-06 ref|WP_073470630.1| hypothetical protein [Enterococcus faecium] 53 4e-06 ref|WP_073990112.1| hypothetical protein [Enterococcus faecium] 54 4e-06 ref|WP_073990038.1| hypothetical protein [Enterococcus faecium] 54 5e-06 ref|WP_073495466.1| hypothetical protein [Enterococcus faecalis] 54 5e-06 ref|WP_073495589.1| hypothetical protein [Enterococcus faecalis] 52 9e-06 >ref|WP_082197627.1| hypothetical protein [Enterococcus faecium] Length = 104 Score = 56.2 bits (134), Expect = 5e-07 Identities = 35/73 (47%), Positives = 40/73 (54%), Gaps = 2/73 (2%) Frame = +1 Query: 1 FFFNDTATTEIYTLSLHDALPISHITPICSGRSAVDEILSIALIDCS--SSLCQEQRSRA 174 FFFNDTATTEIYTLSLHDALPI +P+ G V L LI+ S + Sbjct: 14 FFFNDTATTEIYTLSLHDALPILGGSPVPMGSDEVYTSLQSNLINGSENNEFVLYTAGHG 73 Query: 175 GECRTEESDQSLQ 213 G R+EE LQ Sbjct: 74 GVARSEEHTSELQ 86 >ref|WP_082195859.1| hypothetical protein [Enterococcus faecium] Length = 69 Score = 53.1 bits (126), Expect = 3e-06 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +2 Query: 2 FFLMIRRPPRSTLFPYTTLFR-SPTSRPSALGGAPSTKSFP 121 FFLMIRRPPRSTLFPYTTLFR SP+ R + + S+K+ P Sbjct: 12 FFLMIRRPPRSTLFPYTTLFRSSPSFRTNGVPEVASSKNKP 52 >ref|WP_073470585.1| hypothetical protein [Enterococcus faecium] Length = 71 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 2 FFLMIRRPPRSTLFPYTTLFRSPTSRPSALGGAPSTKSF 118 FFLMIRRPPRSTLFPYTTLFRS R + A + F Sbjct: 10 FFLMIRRPPRSTLFPYTTLFRSSLERIETISSAMELRRF 48 >ref|WP_072539064.1| hypothetical protein [Enterococcus faecium] Length = 86 Score = 53.5 bits (127), Expect = 3e-06 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +2 Query: 2 FFLMIRRPPRSTLFPYTTLFRSPTSRPSALGG 97 FFLMIRRPPRSTLFPYTTLFRS +S GG Sbjct: 4 FFLMIRRPPRSTLFPYTTLFRSESSAKVVAGG 35 >ref|WP_073470630.1| hypothetical protein [Enterococcus faecium] Length = 79 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +2 Query: 2 FFLMIRRPPRSTLFPYTTLFRSPTSRPSALGG 97 FFLMIRRPPRSTLFPYTTLFRSP+ + G Sbjct: 11 FFLMIRRPPRSTLFPYTTLFRSPSLSIQVING 42 >ref|WP_073990112.1| hypothetical protein [Enterococcus faecium] Length = 93 Score = 53.5 bits (127), Expect = 4e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 1 FFFNDTATTEIYTLSLHDALPISHITPICSGRSAVDEIL 117 FFFNDTATTEIYTLSLHDAL PICSG+S + +++ Sbjct: 9 FFFNDTATTEIYTLSLHDAL------PICSGKSTLIQLI 41 >ref|WP_073990038.1| hypothetical protein [Enterococcus faecium] Length = 100 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +1 Query: 1 FFFNDTATTEIYTLSLHDALPISH 72 FFFNDTATTEIYTLSLHDALPISH Sbjct: 23 FFFNDTATTEIYTLSLHDALPISH 46 >ref|WP_073495466.1| hypothetical protein [Enterococcus faecalis] Length = 102 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +1 Query: 1 FFFNDTATTEIYTLSLHDALPISHITPICSGRSAVDE 111 FFFNDTATTEIYTLSLHDALPIS ++ + + A+ E Sbjct: 17 FFFNDTATTEIYTLSLHDALPISVLSELAPFKEALPE 53 >ref|WP_073495589.1| hypothetical protein [Enterococcus faecalis] Length = 82 Score = 52.4 bits (124), Expect = 9e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 FFFNDTATTEIYTLSLHDALPISHI 75 FFFNDTATTEIYTLSLHDALPIS++ Sbjct: 21 FFFNDTATTEIYTLSLHDALPISYV 45