BLASTX nr result
ID: Cheilocostus21_contig00049307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00049307 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009410834.1| PREDICTED: protein SDE2 homolog [Musa acumin... 47 2e-09 ref|XP_010913580.1| PREDICTED: protein SDE2 homolog [Elaeis guin... 48 6e-08 ref|XP_008776845.1| PREDICTED: protein SDE2 homolog [Phoenix dac... 47 8e-08 ref|XP_020105336.1| protein SDE2 homolog [Ananas comosus] 45 5e-07 gb|OAY82760.1| Protein SDE [Ananas comosus] 45 5e-07 >ref|XP_009410834.1| PREDICTED: protein SDE2 homolog [Musa acuminata subsp. malaccensis] Length = 436 Score = 47.4 bits (111), Expect(3) = 2e-09 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -1 Query: 328 FFRKKTKKVKNTSTAVVDEYLEVRRADTEKCTAKVEES 215 F +KK K+VK STA V++YLE R D EKC +VEES Sbjct: 142 FLKKKAKEVKKNSTAAVEKYLEKYREDAEKCMEEVEES 179 Score = 30.8 bits (68), Expect(3) = 2e-09 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 399 RDISGRLLRHVNADKK 352 RD+SGR LRHVNA+KK Sbjct: 107 RDMSGRRLRHVNAEKK 122 Score = 30.8 bits (68), Expect(3) = 2e-09 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = -3 Query: 200 SLYMES**KNLPLSEPLS*RPKIW 129 SLY ES K LPLSEP S R KIW Sbjct: 185 SLYKESKRKILPLSEPSSKRLKIW 208 >ref|XP_010913580.1| PREDICTED: protein SDE2 homolog [Elaeis guineensis] Length = 441 Score = 47.8 bits (112), Expect(3) = 6e-08 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -1 Query: 328 FFRKKTKKVKNTSTAVVDEYLEVRRADTEKCTAKVEES 215 F +KK K+VK ST V++YLE R DTEKC +VEES Sbjct: 142 FLKKKAKEVKKNSTVAVEKYLEKYREDTEKCMEEVEES 179 Score = 30.8 bits (68), Expect(3) = 6e-08 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 399 RDISGRLLRHVNADKK 352 RD+SGR LRHVNA+KK Sbjct: 107 RDMSGRRLRHVNAEKK 122 Score = 25.0 bits (53), Expect(3) = 6e-08 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 197 LYMES**KNLPLSEPLS*RPKIW 129 LY ES K LP S+P + R KIW Sbjct: 186 LYKESKRKILPTSDPSNKRLKIW 208 >ref|XP_008776845.1| PREDICTED: protein SDE2 homolog [Phoenix dactylifera] Length = 441 Score = 47.0 bits (110), Expect(3) = 8e-08 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -1 Query: 328 FFRKKTKKVKNTSTAVVDEYLEVRRADTEKCTAKVEES 215 F +KK K+VK ST V++YLE R DTEKC +VEES Sbjct: 142 FLKKKAKEVKKNSTVEVEKYLEKYREDTEKCMEEVEES 179 Score = 30.8 bits (68), Expect(3) = 8e-08 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 399 RDISGRLLRHVNADKK 352 RD+SGR LRHVNA+KK Sbjct: 107 RDMSGRRLRHVNAEKK 122 Score = 25.4 bits (54), Expect(3) = 8e-08 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 197 LYMES**KNLPLSEPLS*RPKIW 129 LY ES K LP S+P + R KIW Sbjct: 186 LYKESKRKMLPTSDPSNKRLKIW 208 >ref|XP_020105336.1| protein SDE2 homolog [Ananas comosus] Length = 448 Score = 45.4 bits (106), Expect(3) = 5e-07 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = -1 Query: 328 FFRKKTKKVKNTSTAVVDEYLEVRRADTEKCTAKVEES 215 F RKK K+V+ S+ VD+YLE R D EKC +VEES Sbjct: 143 FLRKKAKEVQRNSSTAVDKYLEKFREDAEKCVEEVEES 180 Score = 30.8 bits (68), Expect(3) = 5e-07 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 399 RDISGRLLRHVNADKK 352 RD+SGR LRHVNA+KK Sbjct: 108 RDMSGRRLRHVNAEKK 123 Score = 24.3 bits (51), Expect(3) = 5e-07 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 194 YMES**KNLPLSEPLS*RPKIW 129 Y ES K LP+SEP R KIW Sbjct: 188 YKESKRKLLPVSEPSLKRLKIW 209 >gb|OAY82760.1| Protein SDE [Ananas comosus] Length = 448 Score = 45.4 bits (106), Expect(3) = 5e-07 Identities = 21/38 (55%), Positives = 26/38 (68%) Frame = -1 Query: 328 FFRKKTKKVKNTSTAVVDEYLEVRRADTEKCTAKVEES 215 F RKK K+V+ S+ VD+YLE R D EKC +VEES Sbjct: 143 FLRKKAKEVQRNSSTAVDKYLEKFREDAEKCVEEVEES 180 Score = 30.8 bits (68), Expect(3) = 5e-07 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 399 RDISGRLLRHVNADKK 352 RD+SGR LRHVNA+KK Sbjct: 108 RDMSGRRLRHVNAEKK 123 Score = 24.3 bits (51), Expect(3) = 5e-07 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 194 YMES**KNLPLSEPLS*RPKIW 129 Y ES K LP+SEP R KIW Sbjct: 188 YKESKRKLLPVSEPSLKRLKIW 209