BLASTX nr result
ID: Cheilocostus21_contig00049037
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00049037 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009414098.1| PREDICTED: glutamate decarboxylase 5 isoform... 58 6e-07 >ref|XP_009414098.1| PREDICTED: glutamate decarboxylase 5 isoform X2 [Musa acuminata subsp. malaccensis] Length = 499 Score = 57.8 bits (138), Expect = 6e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 327 MALTTTKLDTEESLHSTFASRYVRASLPRF 416 MA+TTTKLDT ESLHSTFASRYVRASLPRF Sbjct: 1 MAVTTTKLDTGESLHSTFASRYVRASLPRF 30