BLASTX nr result
ID: Cheilocostus21_contig00048669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00048669 (1753 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016546290.1| PREDICTED: uncharacterized protein LOC107846... 62 3e-06 >ref|XP_016546290.1| PREDICTED: uncharacterized protein LOC107846399 [Capsicum annuum] Length = 431 Score = 61.6 bits (148), Expect = 3e-06 Identities = 33/74 (44%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Frame = -3 Query: 911 LTKLVYFFMIQMTCNLQVFSMTIY*QGVVGLYGIPFTIILERVT*FILRFWQLVQHIMG- 735 LTK YFF +Q+T N + + IY + +V LYG+ +II +R T F FW+ + +G Sbjct: 190 LTKSAYFFTVQVTYNAEKLAK-IYLKEIVQLYGVQISIISDRGTQFTCTFWKKLHEKLGT 248 Query: 734 HLSVNTTFHPQIDG 693 L ++TTFHPQIDG Sbjct: 249 RLDLSTTFHPQIDG 262