BLASTX nr result
ID: Cheilocostus21_contig00047739
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047739 (613 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009379990.1| PREDICTED: U-box domain-containing protein 9... 59 8e-07 ref|XP_006648643.1| PREDICTED: U-box domain-containing protein 9... 56 9e-06 ref|XP_002453828.1| U-box domain-containing protein 9 [Sorghum b... 56 9e-06 ref|NP_001150782.1| uncharacterized protein LOC100284415 [Zea ma... 56 9e-06 ref|XP_020111916.1| U-box domain-containing protein 9 [Ananas co... 56 9e-06 >ref|XP_009379990.1| PREDICTED: U-box domain-containing protein 9 [Musa acuminata subsp. malaccensis] Length = 480 Score = 59.3 bits (142), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 RVELKAVPEHFRCPISSELMRDPVVLASGQVYD 99 R++ +VPEHFRCPISSELM+DPVVLASGQ YD Sbjct: 88 RMDSASVPEHFRCPISSELMKDPVVLASGQTYD 120 >ref|XP_006648643.1| PREDICTED: U-box domain-containing protein 9-like, partial [Oryza brachyantha] Length = 405 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 16 AVPEHFRCPISSELMRDPVVLASGQVYD 99 AVPEHF CPISSE+MRDPVVLASGQ YD Sbjct: 20 AVPEHFLCPISSEIMRDPVVLASGQTYD 47 >ref|XP_002453828.1| U-box domain-containing protein 9 [Sorghum bicolor] gb|EES06804.1| hypothetical protein SORBI_3004G146800 [Sorghum bicolor] Length = 464 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 16 AVPEHFRCPISSELMRDPVVLASGQVYD 99 AVPEHF CPISSE+MRDPVVLASGQ YD Sbjct: 79 AVPEHFLCPISSEIMRDPVVLASGQTYD 106 >ref|NP_001150782.1| uncharacterized protein LOC100284415 [Zea mays] gb|ACG40355.1| spotted leaf protein 11 [Zea mays] gb|AQK70956.1| Spotted leaf protein 11 [Zea mays] Length = 465 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 16 AVPEHFRCPISSELMRDPVVLASGQVYD 99 AVPEHF CPISSE+MRDPVVLASGQ YD Sbjct: 72 AVPEHFLCPISSEIMRDPVVLASGQTYD 99 >ref|XP_020111916.1| U-box domain-containing protein 9 [Ananas comosus] gb|OAY83728.1| U-box domain-containing protein 9 [Ananas comosus] Length = 477 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 16 AVPEHFRCPISSELMRDPVVLASGQVYD 99 AVPEHF CPISSE+MRDPVVLASGQ YD Sbjct: 93 AVPEHFLCPISSEIMRDPVVLASGQTYD 120