BLASTX nr result
ID: Cheilocostus21_contig00047677
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047677 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018679011.1| PREDICTED: inactive TPR repeat-containing th... 55 7e-06 ref|XP_009393996.1| PREDICTED: inactive TPR repeat-containing th... 55 7e-06 ref|XP_018679010.1| PREDICTED: inactive TPR repeat-containing th... 55 7e-06 ref|XP_018679009.1| PREDICTED: inactive TPR repeat-containing th... 55 7e-06 ref|XP_018679008.1| PREDICTED: inactive TPR repeat-containing th... 55 7e-06 ref|XP_018679007.1| PREDICTED: inactive TPR repeat-containing th... 55 7e-06 ref|XP_018679006.1| PREDICTED: inactive TPR repeat-containing th... 55 7e-06 >ref|XP_018679011.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X7 [Musa acuminata subsp. malaccensis] Length = 666 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 163 MDEENARQASGCGFFVLYNNIFRRVPEPNSSSRYPSSAVQSPKVSPVDTKCR 8 M+EE+ ++ SGCG VLYNNIFRR +SS +P+SA +SPK++ D+K R Sbjct: 1 MEEEDGKKVSGCGLLVLYNNIFRR-GTASSSPGHPTSAAESPKLTASDSKRR 51 >ref|XP_009393996.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X6 [Musa acuminata subsp. malaccensis] Length = 679 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 163 MDEENARQASGCGFFVLYNNIFRRVPEPNSSSRYPSSAVQSPKVSPVDTKCR 8 M+EE+ ++ SGCG VLYNNIFRR +SS +P+SA +SPK++ D+K R Sbjct: 1 MEEEDGKKVSGCGLLVLYNNIFRR-GTASSSPGHPTSAAESPKLTASDSKRR 51 >ref|XP_018679010.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X5 [Musa acuminata subsp. malaccensis] Length = 682 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 163 MDEENARQASGCGFFVLYNNIFRRVPEPNSSSRYPSSAVQSPKVSPVDTKCR 8 M+EE+ ++ SGCG VLYNNIFRR +SS +P+SA +SPK++ D+K R Sbjct: 1 MEEEDGKKVSGCGLLVLYNNIFRR-GTASSSPGHPTSAAESPKLTASDSKRR 51 >ref|XP_018679009.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X4 [Musa acuminata subsp. malaccensis] Length = 709 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 163 MDEENARQASGCGFFVLYNNIFRRVPEPNSSSRYPSSAVQSPKVSPVDTKCR 8 M+EE+ ++ SGCG VLYNNIFRR +SS +P+SA +SPK++ D+K R Sbjct: 1 MEEEDGKKVSGCGLLVLYNNIFRR-GTASSSPGHPTSAAESPKLTASDSKRR 51 >ref|XP_018679008.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 714 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 163 MDEENARQASGCGFFVLYNNIFRRVPEPNSSSRYPSSAVQSPKVSPVDTKCR 8 M+EE+ ++ SGCG VLYNNIFRR +SS +P+SA +SPK++ D+K R Sbjct: 1 MEEEDGKKVSGCGLLVLYNNIFRR-GTASSSPGHPTSAAESPKLTASDSKRR 51 >ref|XP_018679007.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 738 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 163 MDEENARQASGCGFFVLYNNIFRRVPEPNSSSRYPSSAVQSPKVSPVDTKCR 8 M+EE+ ++ SGCG VLYNNIFRR +SS +P+SA +SPK++ D+K R Sbjct: 1 MEEEDGKKVSGCGLLVLYNNIFRR-GTASSSPGHPTSAAESPKLTASDSKRR 51 >ref|XP_018679006.1| PREDICTED: inactive TPR repeat-containing thioredoxin TTL3-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 741 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 163 MDEENARQASGCGFFVLYNNIFRRVPEPNSSSRYPSSAVQSPKVSPVDTKCR 8 M+EE+ ++ SGCG VLYNNIFRR +SS +P+SA +SPK++ D+K R Sbjct: 1 MEEEDGKKVSGCGLLVLYNNIFRR-GTASSSPGHPTSAAESPKLTASDSKRR 51