BLASTX nr result
ID: Cheilocostus21_contig00047666
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047666 (742 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS62520.1| hypothetical protein TRIUR3_26009 [Triticum urartu] 55 1e-05 >gb|EMS62520.1| hypothetical protein TRIUR3_26009 [Triticum urartu] Length = 151 Score = 54.7 bits (130), Expect = 1e-05 Identities = 32/86 (37%), Positives = 49/86 (56%), Gaps = 4/86 (4%) Frame = +3 Query: 159 QFVLWAISSLAGLLTFLVFRTAALLVVGVIHLFKLPRQASSGAAD----LIRSATVQVLG 326 + LW + S L ++FR ALL V + L +LP QA+ A + ++ +A V G Sbjct: 8 RLALWLLGSCLELAALVLFRGLALLAVAAVDLVRLPGQAADAALNATKGVLEAAVEFVFG 67 Query: 327 LLKDLLVSVASGLLEALESAVAGSFQ 404 L+ D+ V+V S LE+L SAVAG+ + Sbjct: 68 LVWDVAVAVVSAFLESLWSAVAGTVE 93