BLASTX nr result
ID: Cheilocostus21_contig00047653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047653 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023911213.1| actin-regulating kinase PRK1-like [Quercus s... 53 5e-06 >ref|XP_023911213.1| actin-regulating kinase PRK1-like [Quercus suber] Length = 102 Score = 52.8 bits (125), Expect = 5e-06 Identities = 24/43 (55%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = -1 Query: 120 LKCFILNMGSLIIY---ITRDLKAENVLLGADGAWKLCDFGST 1 ++ + N+ L+++ I RDLKAEN+LLG+DG WKLCDFGST Sbjct: 1 MRVLLRNIYDLLLFLPLIFRDLKAENLLLGSDGVWKLCDFGST 43