BLASTX nr result
ID: Cheilocostus21_contig00047629
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047629 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009387753.1| PREDICTED: uncharacterized protein LOC103974... 77 3e-13 >ref|XP_009387753.1| PREDICTED: uncharacterized protein LOC103974615 [Musa acuminata subsp. malaccensis] Length = 878 Score = 76.6 bits (187), Expect = 3e-13 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -1 Query: 121 MEGSLQHQNSTTAFQRNYKSCMWDWLRVFDLHHRVTVRKL 2 MEG LQHQNST +FQ+NYKSCMWDWLR+FDL HR++VR+L Sbjct: 1 MEGLLQHQNSTASFQKNYKSCMWDWLRIFDLQHRLSVRRL 40