BLASTX nr result
ID: Cheilocostus21_contig00047514
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047514 (540 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024162280.1| uncharacterized protein LOC112169478 [Rosa c... 55 7e-06 >ref|XP_024162280.1| uncharacterized protein LOC112169478 [Rosa chinensis] Length = 191 Score = 54.7 bits (130), Expect = 7e-06 Identities = 23/64 (35%), Positives = 37/64 (57%) Frame = -2 Query: 275 SRKKHWRRSPIGHLKVNTNGAWDKDSNDAGV*YIIKDNNAKVIVAVALFHRSNSALLAKL 96 S HW + HLKVNT+ WD +N G+ +++D+N ++ + F ++S L A+ Sbjct: 23 SHDTHWTAPKVSHLKVNTDATWDSSTNSCGIAAVVRDSNGLLVGGSSRFDMASSPLAAEA 82 Query: 95 LAIQ 84 LAIQ Sbjct: 83 LAIQ 86