BLASTX nr result
ID: Cheilocostus21_contig00047492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047492 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIT20185.1| hypothetical protein A4A49_64530 [Nicotiana atten... 54 7e-06 >gb|OIT20185.1| hypothetical protein A4A49_64530 [Nicotiana attenuata] Length = 165 Score = 53.5 bits (127), Expect = 7e-06 Identities = 33/87 (37%), Positives = 44/87 (50%), Gaps = 8/87 (9%) Frame = -1 Query: 452 SKKSGSDEKAGP--RQDADRAGDRPGLPKP-----HAGTARPTR-GGCSVCGGAHFAKDC 297 SK G +KA + +A + GL K H G R + GC CGG H KDC Sbjct: 61 SKSDGRKDKAKEWKKSGKGQAAENEGLVKNVRQEIHNGKERSGKFKGCFTCGGPHLKKDC 120 Query: 296 PKRERINAMLAEEEEGQVMMMHPMVLE 216 P + R+NAMLA E++ QV H +V + Sbjct: 121 PVQARVNAMLAAEKQEQVAEAHAIVAD 147