BLASTX nr result
ID: Cheilocostus21_contig00047138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047138 (525 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009391969.1| PREDICTED: uncharacterized protein LOC103978... 54 3e-06 >ref|XP_009391969.1| PREDICTED: uncharacterized protein LOC103978000 [Musa acuminata subsp. malaccensis] Length = 179 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 1/58 (1%) Frame = +2 Query: 44 VSDLESFRSVLQESKRTPHKLTKQQVMMTHKLT-RQR*LQDKEYMQP*ENPTPSSTER 214 +S+LE+ RSVL+ES+R KL KQ M +LT R + L+DKE+ P +NPTP + ER Sbjct: 80 ISELEAIRSVLEESERRVEKLEKQGDKMIQELTQRAKELRDKEFKLPYQNPTPCTAER 137 Score = 25.4 bits (54), Expect(2) = 3e-06 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 210 REACQNCYKEQRARGPVKIFTVM 278 REAC NCYKE P+K V+ Sbjct: 137 REACLNCYKEHET-DPLKCARVV 158