BLASTX nr result
ID: Cheilocostus21_contig00047113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00047113 (1118 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKA61481.1| hypothetical protein AXF42_Ash014398 [Apostasia s... 61 2e-06 gb|PKA60564.1| hypothetical protein AXF42_Ash019457 [Apostasia s... 60 4e-06 >gb|PKA61481.1| hypothetical protein AXF42_Ash014398 [Apostasia shenzhenica] Length = 419 Score = 60.8 bits (146), Expect = 2e-06 Identities = 31/85 (36%), Positives = 54/85 (63%) Frame = -3 Query: 339 QPCKPIDLRIITSTSHPFEFALAFAQCLAELHNKIW*RINLSSYKYQTVANEHKRPHTFE 160 +P KPIDL + + EFA +FAQ + +LH +I +++L+ KY+++A+ H++ F Sbjct: 151 EPRKPIDLIELLVSYRTSEFASSFAQHMHDLHKEIKQKLSLNYAKYKSIADSHRKLKKFS 210 Query: 159 KGELVMVRVNSERLTMGLN*KLHAR 85 +G+ VM+ VN+ R G + KL A+ Sbjct: 211 EGDYVMIHVNAARFPPGKSKKLTAK 235 >gb|PKA60564.1| hypothetical protein AXF42_Ash019457 [Apostasia shenzhenica] Length = 419 Score = 59.7 bits (143), Expect = 4e-06 Identities = 33/85 (38%), Positives = 52/85 (61%) Frame = -3 Query: 339 QPCKPIDLRIITSTSHPFEFALAFAQCLAELHNKIW*RINLSSYKYQTVANEHKRPHTFE 160 +P KPIDL + + EFA +FAQ + +LH +I ++ + KY+++A+ H+R F Sbjct: 151 EPRKPIDLIELPVSYRTSEFASSFAQHMHDLHEEIKQKLAFNYAKYKSIADSHRRVVEFS 210 Query: 159 KGELVMVRVNSERLTMGLN*KLHAR 85 G+ VMV VNS R + G + KL A+ Sbjct: 211 VGDYVMVHVNSVRFSHGKSKKLTAK 235