BLASTX nr result
ID: Cheilocostus21_contig00046426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00046426 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59619.1| uncharacterized protein A4U43_C08F8330 [Asparagus... 94 2e-20 ref|XP_020575206.1| pentatricopeptide repeat-containing protein ... 89 1e-17 ref|XP_009396024.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-17 ref|XP_020672506.1| pentatricopeptide repeat-containing protein ... 85 2e-16 ref|XP_020088306.1| pentatricopeptide repeat-containing protein ... 81 5e-16 ref|XP_008646055.1| pentatricopeptide repeat-containing protein ... 82 2e-15 gb|PAN07577.1| hypothetical protein PAHAL_A02913 [Panicum hallii... 82 2e-15 dbj|BAD29374.1| pentatricopeptide (PPR) repeat-containing protei... 82 2e-15 ref|XP_015622896.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-15 ref|XP_020092212.1| pentatricopeptide repeat-containing protein ... 81 3e-15 ref|XP_006647686.2| PREDICTED: pentatricopeptide repeat-containi... 82 3e-15 ref|XP_002452757.2| pentatricopeptide repeat-containing protein ... 81 4e-15 ref|XP_020092115.1| pentatricopeptide repeat-containing protein ... 81 4e-15 ref|XP_022679996.1| pentatricopeptide repeat-containing protein ... 81 5e-15 gb|PKA49706.1| Pentatricopeptide repeat-containing protein [Apos... 80 1e-14 ref|XP_003634254.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-14 dbj|GAV66254.1| PPR_1 domain-containing protein/PPR_2 domain-con... 78 6e-14 dbj|BAK06798.1| predicted protein, partial [Hordeum vulgare subs... 78 6e-14 ref|XP_003572818.1| PREDICTED: pentatricopeptide repeat-containi... 78 6e-14 ref|XP_020195039.1| pentatricopeptide repeat-containing protein ... 78 6e-14 >gb|ONK59619.1| uncharacterized protein A4U43_C08F8330 [Asparagus officinalis] Length = 274 Score = 93.6 bits (231), Expect = 2e-20 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 VI+MVERGHLPRKFMFNR+LNGLLLTGNQ FAK+LLR+Q+ FGRLQREIRL Sbjct: 224 VIDMVERGHLPRKFMFNRILNGLLLTGNQGFAKELLRMQDRFGRLQREIRL 274 >ref|XP_020575206.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Phalaenopsis equestris] Length = 499 Score = 88.6 bits (218), Expect = 1e-17 Identities = 41/51 (80%), Positives = 49/51 (96%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMVE GHLPR+FMFN+VLNGLLLTGNQDFA+++LRLQ+ FGRL+REIRL Sbjct: 449 VMEMVECGHLPRRFMFNKVLNGLLLTGNQDFAREMLRLQDRFGRLRREIRL 499 >ref|XP_009396024.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Musa acuminata subsp. malaccensis] Length = 515 Score = 87.4 bits (215), Expect = 3e-17 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMVERGHLPRKFMFNR+LNGLLLTGNQ+FAK+LLRLQE + L REIRL Sbjct: 465 VMEMVERGHLPRKFMFNRILNGLLLTGNQEFAKELLRLQEKYRCLHREIRL 515 >ref|XP_020672506.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Dendrobium catenatum] gb|PKU73246.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 505 Score = 85.1 bits (209), Expect = 2e-16 Identities = 38/51 (74%), Positives = 48/51 (94%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EM E GHLPR+FMFN+VLNGLLLTGNQ+FA++LLR+Q+ FGRL+RE+RL Sbjct: 455 VMEMAESGHLPRRFMFNKVLNGLLLTGNQEFARELLRMQDRFGRLRREMRL 505 >ref|XP_020088306.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Ananas comosus] Length = 232 Score = 81.3 bits (199), Expect = 5e-16 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V EMVERG LPR+FMFNRV+NGLL+TGNQDFA++LLRLQ+ GRL+REI++ Sbjct: 182 VREMVERGFLPRRFMFNRVVNGLLVTGNQDFARELLRLQDKCGRLRREIKI 232 >ref|XP_008646055.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Zea mays] ref|XP_008646056.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Zea mays] gb|AQK73534.1| Pentatricopeptide repeat (PPR) superfamily protein [Zea mays] Length = 501 Score = 82.4 bits (202), Expect = 2e-15 Identities = 37/51 (72%), Positives = 48/51 (94%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMV+RG+LPRKFMFNRVLNGL+LTGNQ+ +++LLR+QE + RL+REIRL Sbjct: 451 VVEMVDRGYLPRKFMFNRVLNGLMLTGNQELSRELLRMQEKYTRLRREIRL 501 >gb|PAN07577.1| hypothetical protein PAHAL_A02913 [Panicum hallii] gb|PAN07578.1| hypothetical protein PAHAL_A02913 [Panicum hallii] gb|PAN07579.1| hypothetical protein PAHAL_A02913 [Panicum hallii] gb|PAN07580.1| hypothetical protein PAHAL_A02913 [Panicum hallii] Length = 502 Score = 82.4 bits (202), Expect = 2e-15 Identities = 36/51 (70%), Positives = 48/51 (94%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V++MV+RG+LPR+FMFNRVLNGL+LTGNQ+ ++KLLR+QE + RL+REIRL Sbjct: 452 VVDMVDRGYLPRRFMFNRVLNGLMLTGNQELSRKLLRMQEKYARLRREIRL 502 >dbj|BAD29374.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] dbj|BAF09650.1| Os02g0679200 [Oryza sativa Japonica Group] dbj|BAS80289.1| Os02g0679200 [Oryza sativa Japonica Group] Length = 491 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V EMV+RG+LPR+FMFNRVLNGL+LTGNQ+ ++KLLR+QE + RLQREIRL Sbjct: 441 VEEMVDRGYLPRRFMFNRVLNGLMLTGNQELSRKLLRMQEKYRRLQREIRL 491 >ref|XP_015622896.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Oryza sativa Japonica Group] ref|XP_015622897.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Oryza sativa Japonica Group] Length = 524 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V EMV+RG+LPR+FMFNRVLNGL+LTGNQ+ ++KLLR+QE + RLQREIRL Sbjct: 474 VEEMVDRGYLPRRFMFNRVLNGLMLTGNQELSRKLLRMQEKYRRLQREIRL 524 >ref|XP_020092212.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Ananas comosus] Length = 386 Score = 81.3 bits (199), Expect = 3e-15 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V EMVERG LPR+FMFN+V+NGLL+TGNQDFA++LLRLQ+ GRL+REIR+ Sbjct: 336 VREMVERGFLPRRFMFNKVVNGLLVTGNQDFARELLRLQDKCGRLRREIRI 386 >ref|XP_006647686.2| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Oryza brachyantha] Length = 556 Score = 81.6 bits (200), Expect = 3e-15 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V EMV+RG+LPR+FMFNRVLNGL+LTGNQ+ ++KLLR+QE + RLQREIRL Sbjct: 506 VEEMVDRGYLPRRFMFNRVLNGLMLTGNQELSQKLLRMQEKYRRLQREIRL 556 >ref|XP_002452757.2| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Sorghum bicolor] gb|KXG31012.1| hypothetical protein SORBI_3004G282500 [Sorghum bicolor] gb|OQU85633.1| hypothetical protein SORBI_3004G282500 [Sorghum bicolor] gb|OQU85634.1| hypothetical protein SORBI_3004G282500 [Sorghum bicolor] Length = 502 Score = 81.3 bits (199), Expect = 4e-15 Identities = 36/51 (70%), Positives = 48/51 (94%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMV+RG+LPR+FMFNRVLNGL+LTGNQ+ +++LLR+QE + RL+REIRL Sbjct: 452 VVEMVDRGYLPRRFMFNRVLNGLMLTGNQELSRELLRMQEKYTRLRREIRL 502 >ref|XP_020092115.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial-like [Ananas comosus] Length = 603 Score = 81.3 bits (199), Expect = 4e-15 Identities = 38/51 (74%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V EMVERG LPR+FMFN+V+NGLL+TGNQDFA++LLRLQ+ GRL+REIR+ Sbjct: 553 VREMVERGFLPRRFMFNKVVNGLLVTGNQDFARELLRLQDKCGRLRREIRI 603 >ref|XP_022679996.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Setaria italica] ref|XP_022679998.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Setaria italica] ref|XP_022680000.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Setaria italica] gb|KQL30934.1| hypothetical protein SETIT_019714mg [Setaria italica] Length = 505 Score = 80.9 bits (198), Expect = 5e-15 Identities = 35/51 (68%), Positives = 48/51 (94%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V++MV+RG+LPR+FMFNRVLNGL+LTGNQ+ +++LLR+QE + RL+REIRL Sbjct: 455 VVDMVDRGYLPRRFMFNRVLNGLMLTGNQELSRELLRMQEKYARLRREIRL 505 >gb|PKA49706.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 521 Score = 80.1 bits (196), Expect = 1e-14 Identities = 36/51 (70%), Positives = 47/51 (92%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMVE+G+LPRKFMFN+VLNGLL+TGNQ FA+++LR+QE F R++R IRL Sbjct: 471 VVEMVEKGYLPRKFMFNKVLNGLLVTGNQCFAREILRMQERFTRMRRNIRL 521 >ref|XP_003634254.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Vitis vinifera] Length = 450 Score = 79.0 bits (193), Expect = 2e-14 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 +IEMVERG LPRKF FNRVL+GLLLTGNQDFAK++LRLQ GRL R ++L Sbjct: 400 LIEMVERGFLPRKFTFNRVLDGLLLTGNQDFAKEILRLQSRCGRLPRRLKL 450 >dbj|GAV66254.1| PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 485 Score = 77.8 bits (190), Expect = 6e-14 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 +IEMV+RG +PRKF FNRVLNGLLLTGNQ+FAK++LRLQ GRL R+++L Sbjct: 435 LIEMVDRGFMPRKFTFNRVLNGLLLTGNQEFAKEILRLQSRCGRLPRKLKL 485 >dbj|BAK06798.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 489 Score = 77.8 bits (190), Expect = 6e-14 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMVERG+LPR+FM NRVLNGL+LTGNQ ++ LLR+QE + RL+REIRL Sbjct: 439 VMEMVERGYLPRRFMLNRVLNGLMLTGNQQISRDLLRMQEKYRRLRREIRL 489 >ref|XP_003572818.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Brachypodium distachyon] ref|XP_014755798.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Brachypodium distachyon] ref|XP_014755799.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Brachypodium distachyon] gb|KQK00768.1| hypothetical protein BRADI_3g51690v3 [Brachypodium distachyon] gb|KQK00769.1| hypothetical protein BRADI_3g51690v3 [Brachypodium distachyon] gb|PNT69235.1| hypothetical protein BRADI_3g51690v3 [Brachypodium distachyon] Length = 496 Score = 77.8 bits (190), Expect = 6e-14 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMVERG+LPR+FM NRVLNGL+LTGNQ ++ LLR+QE + RL+REIRL Sbjct: 446 VMEMVERGYLPRRFMLNRVLNGLMLTGNQQLSRDLLRMQEKYRRLRREIRL 496 >ref|XP_020195039.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Aegilops tauschii subsp. tauschii] ref|XP_020195040.1| pentatricopeptide repeat-containing protein At1g74900, mitochondrial [Aegilops tauschii subsp. tauschii] Length = 497 Score = 77.8 bits (190), Expect = 6e-14 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 VIEMVERGHLPRKFMFNRVLNGLLLTGNQDFAKKLLRLQENFGRLQREIRL 153 V+EMVERG+LPR+FM NRVLNGL+LTGNQ ++ LLR+QE + RL+REIRL Sbjct: 447 VMEMVERGYLPRRFMLNRVLNGLMLTGNQQISRDLLRMQEKYRRLRREIRL 497