BLASTX nr result
ID: Cheilocostus21_contig00046396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00046396 (859 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012568789.1| PREDICTED: uncharacterized protein LOC101505... 71 3e-11 >ref|XP_012568789.1| PREDICTED: uncharacterized protein LOC101505739 [Cicer arietinum] ref|XP_012568790.1| PREDICTED: uncharacterized protein LOC101505739 [Cicer arietinum] Length = 176 Score = 71.2 bits (173), Expect = 3e-11 Identities = 40/98 (40%), Positives = 63/98 (64%), Gaps = 3/98 (3%) Frame = -1 Query: 850 KIAKATRGAIVMGGLVTQIALVLGV--DPTNMERARGNPRINLESCLAMKFLIKEGDNYF 677 K+AKA++G IV+GGL+T IA+ LG D + + +G+ RI+L+SC+AMK + K D Y Sbjct: 44 KVAKASKGDIVIGGLITPIAISLGYTNDIFKLSQVQGHTRIDLDSCIAMKLITKLHDTYH 103 Query: 676 LVFRNLDKTLQLPCQTRTTVRIKANWRVRPLDT-DDQP 566 L+ + + LP RTT++ + NW + ++ DDQP Sbjct: 104 LLLHD-GSAIALPNPARTTIQNRDNWLLSGDNSGDDQP 140