BLASTX nr result
ID: Cheilocostus21_contig00046301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00046301 (765 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009408003.1| PREDICTED: probable plastid-lipid-associated... 74 2e-11 ref|XP_020265524.1| probable plastid-lipid-associated protein 2,... 72 8e-11 ref|XP_010943242.2| PREDICTED: probable plastid-lipid-associated... 70 4e-10 gb|AGN30962.1| chromoplast-specific carotenoid-associated protei... 69 7e-10 ref|XP_020594227.1| chromoplast-specific carotenoid-associated p... 66 7e-10 gb|OAY67540.1| putative plastid-lipid-associated protein 2, chlo... 69 7e-10 ref|XP_008803509.1| PREDICTED: probable plastid-lipid-associated... 68 8e-10 ref|XP_020103093.1| probable plastid-lipid-associated protein 2,... 69 8e-10 ref|XP_008780182.1| PREDICTED: probable plastid-lipid-associated... 68 1e-09 ref|XP_009392110.1| PREDICTED: chromoplast-specific carotenoid-a... 68 1e-09 gb|PIA36878.1| hypothetical protein AQUCO_03200088v1 [Aquilegia ... 67 2e-09 ref|XP_006849074.1| probable plastid-lipid-associated protein 2,... 67 2e-09 ref|XP_010928413.1| PREDICTED: probable plastid-lipid-associated... 67 3e-09 gb|PON52163.1| Plastid lipid-associated protein/fibrillin conser... 67 3e-09 ref|XP_010099142.1| plastid-lipid-associated protein, chloroplas... 67 5e-09 gb|PON91308.1| Plastid lipid-associated protein/fibrillin conser... 67 5e-09 gb|PIA36879.1| hypothetical protein AQUCO_03200088v1 [Aquilegia ... 67 5e-09 ref|XP_008802537.1| PREDICTED: plastid-lipid-associated protein,... 65 5e-09 ref|XP_020579411.1| chromoplast-specific carotenoid-associated p... 66 6e-09 ref|XP_020579401.1| chromoplast-specific carotenoid-associated p... 66 6e-09 >ref|XP_009408003.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Musa acuminata subsp. malaccensis] Length = 305 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 KKL++LL GTDRGLKASSET A ILEVI+QLEA NPTP PT+ALAL Sbjct: 85 KKLIDLLYGTDRGLKASSETRAEILEVITQLEAKNPTPAPTDALAL 130 >ref|XP_020265524.1| probable plastid-lipid-associated protein 2, chloroplastic [Asparagus officinalis] gb|ONK70264.1| uncharacterized protein A4U43_C05F31940 [Asparagus officinalis] Length = 324 Score = 71.6 bits (174), Expect = 8e-11 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 KKL ELL GTDRGLKASSET A I+E+I+QLEA NPTP PTEALAL Sbjct: 102 KKLKELLYGTDRGLKASSETRAEIVELITQLEAKNPTPAPTEALAL 147 >ref|XP_010943242.2| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Elaeis guineensis] Length = 324 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++LL GTDRGLKASSET A I+E+I+QLEA NPTP PTEAL L Sbjct: 102 RKLMDLLRGTDRGLKASSETRAEIVELITQLEAKNPTPAPTEALTL 147 >gb|AGN30962.1| chromoplast-specific carotenoid-associated protein [Narcissus tazetta var. chinensis] Length = 316 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 K+L ELL GTDRGLKASSET A I+E+I+QLEA NPTP PTEAL L Sbjct: 94 KRLKELLYGTDRGLKASSETRAEIVELITQLEAKNPTPAPTEALTL 139 >ref|XP_020594227.1| chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Phalaenopsis equestris] Length = 155 Score = 66.2 bits (160), Expect = 7e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++ L GTDRGLKA+SET A + E+ISQLEA NPTP PTEAL+L Sbjct: 102 RKLIDQLFGTDRGLKATSETRAEVNEIISQLEAKNPTPAPTEALSL 147 >gb|OAY67540.1| putative plastid-lipid-associated protein 2, chloroplastic [Ananas comosus] Length = 328 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 KKL ELL GTDRGLKASSET A ILE+I+QLEA NPTP PT+AL L Sbjct: 108 KKLKELLYGTDRGLKASSETRAEILELITQLEAKNPTPEPTDALPL 153 >ref|XP_008803509.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Phoenix dactylifera] Length = 256 Score = 68.2 bits (165), Expect = 8e-10 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++LL GTDRGL+ASSET A I+E+I+QLEA NPTP PTEAL L Sbjct: 38 RKLMDLLRGTDRGLEASSETRAEIVELITQLEAKNPTPAPTEALTL 83 >ref|XP_020103093.1| probable plastid-lipid-associated protein 2, chloroplastic [Ananas comosus] Length = 337 Score = 68.9 bits (167), Expect = 8e-10 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 KKL ELL GTDRGLKASSET A ILE+I+QLEA NPTP PT+AL L Sbjct: 108 KKLKELLYGTDRGLKASSETRAEILELITQLEAKNPTPEPTDALPL 153 >ref|XP_008780182.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic, partial [Phoenix dactylifera] Length = 281 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL+ELL GTDRGL ASSET A ILE+I+QLE+ NPTP PTEAL L Sbjct: 109 RKLMELLYGTDRGLNASSETRAEILELITQLESKNPTPAPTEALTL 154 >ref|XP_009392110.1| PREDICTED: chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Musa acuminata subsp. malaccensis] Length = 320 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++LL GTDRGLKASSET A I+E+I+QLEA NPTP PT+AL L Sbjct: 98 RKLMDLLSGTDRGLKASSETRAEIVELITQLEAKNPTPAPTDALPL 143 >gb|PIA36878.1| hypothetical protein AQUCO_03200088v1 [Aquilegia coerulea] Length = 233 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 K L++ L GTDRGLKASSET A I+E+I+QLEA NPTP PTEAL L Sbjct: 110 KALIDSLYGTDRGLKASSETRAEIIELITQLEAKNPTPAPTEALTL 155 >ref|XP_006849074.1| probable plastid-lipid-associated protein 2, chloroplastic [Amborella trichopoda] gb|ERN10655.1| hypothetical protein AMTR_s00028p00216930 [Amborella trichopoda] Length = 322 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 K+LVE GT+RGLKASSET A I+E+I+QLEA+NPTP PTEAL L Sbjct: 98 KELVEAFYGTERGLKASSETRAEIVELITQLEALNPTPAPTEALPL 143 >ref|XP_010928413.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic [Elaeis guineensis] Length = 328 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++LL GTDRGL+ASSET A I+EVI+QLE NPTP PTEAL L Sbjct: 106 RKLMDLLYGTDRGLQASSETRAEIVEVINQLEVRNPTPAPTEALTL 151 >gb|PON52163.1| Plastid lipid-associated protein/fibrillin conserved domain containing protein [Parasponia andersonii] Length = 329 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 K LV+ GTDRGLKASSET A I+E+I+QLEA+NPTP PTEAL L Sbjct: 107 KALVDSFYGTDRGLKASSETRAEIVELITQLEALNPTPAPTEALTL 152 >ref|XP_010099142.1| plastid-lipid-associated protein, chloroplastic [Morus notabilis] gb|EXB77014.1| Plastid-lipid-associated protein [Morus notabilis] Length = 324 Score = 66.6 bits (161), Expect = 5e-09 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 K LVE GTDRGLKASSET A I+E+I+QLEA NPTP PTEAL+L Sbjct: 102 KALVESFYGTDRGLKASSETRAEIVELITQLEAQNPTPAPTEALSL 147 >gb|PON91308.1| Plastid lipid-associated protein/fibrillin conserved domain containing protein [Trema orientalis] Length = 327 Score = 66.6 bits (161), Expect = 5e-09 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 K L++ GTDRGLKASSET A I+E+I+QLEA+NPTP PTEAL L Sbjct: 105 KALIDSFYGTDRGLKASSETRAEIVELITQLEALNPTPAPTEALTL 150 >gb|PIA36879.1| hypothetical protein AQUCO_03200088v1 [Aquilegia coerulea] Length = 332 Score = 66.6 bits (161), Expect = 5e-09 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 K L++ L GTDRGLKASSET A I+E+I+QLEA NPTP PTEAL L Sbjct: 110 KALIDSLYGTDRGLKASSETRAEIIELITQLEAKNPTPAPTEALTL 155 >ref|XP_008802537.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like [Phoenix dactylifera] Length = 190 Score = 64.7 bits (156), Expect = 5e-09 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++LL GTDRGL ASSET A ILE+I+QLE+ NPTP P EAL L Sbjct: 48 RKLMDLLYGTDRGLNASSETRAEILELITQLESKNPTPAPIEALTL 93 >ref|XP_020579411.1| chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Phalaenopsis equestris] Length = 324 Score = 66.2 bits (160), Expect = 6e-09 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++ L GTDRGLKA+SET A + E+ISQLEA NPTP PTEAL+L Sbjct: 102 RKLIDQLFGTDRGLKATSETRAEVNEIISQLEAKNPTPAPTEALSL 147 >ref|XP_020579401.1| chromoplast-specific carotenoid-associated protein C1, chromoplastic-like [Phalaenopsis equestris] Length = 324 Score = 66.2 bits (160), Expect = 6e-09 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = +3 Query: 627 KKLVELLEGTDRGLKASSETAARILEVISQLEAINPTPVPTEALAL 764 +KL++ L GTDRGLKA+SET A + E+ISQLEA NPTP PTEAL+L Sbjct: 102 RKLIDQLFGTDRGLKATSETRAEVNEIISQLEAKNPTPAPTEALSL 147