BLASTX nr result
ID: Cheilocostus21_contig00046235
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00046235 (1444 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010918412.1| PREDICTED: uncharacterized protein LOC105042... 61 9e-07 ref|XP_017702231.1| PREDICTED: uncharacterized protein LOC103723... 60 2e-06 >ref|XP_010918412.1| PREDICTED: uncharacterized protein LOC105042790 [Elaeis guineensis] Length = 262 Score = 61.2 bits (147), Expect = 9e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -1 Query: 490 WRSRESLVVCRDELFHRVETFIKNQHENLRLQRQESARRR 371 WR R+ LVV +DELF RVET IK HENLRLQRQES +RR Sbjct: 214 WRRRDVLVVSQDELFRRVETLIKKHHENLRLQRQESEQRR 253 >ref|XP_017702231.1| PREDICTED: uncharacterized protein LOC103723521 [Phoenix dactylifera] Length = 252 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -1 Query: 490 WRSRESLVVCRDELFHRVETFIKNQHENLRLQRQESARRR 371 WR R+ LVV +DELF RVETFI HENLRLQRQ+S +RR Sbjct: 204 WRRRDVLVVSQDELFRRVETFINKHHENLRLQRQQSEQRR 243