BLASTX nr result
ID: Cheilocostus21_contig00046094
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00046094 (1100 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008780764.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 60 2e-07 gb|PKA54944.1| AMSH-like ubiquitin thioesterase 3 [Apostasia she... 60 2e-07 gb|PKI43847.1| hypothetical protein CRG98_035681 [Punica granatum] 60 5e-07 ref|XP_008351920.2| PREDICTED: AMSH-like ubiquitin thioesterase ... 60 5e-07 gb|EPS59442.1| hypothetical protein M569_15365, partial [Genlise... 59 6e-07 ref|XP_002988433.1| hypothetical protein SELMODRAFT_128074, part... 59 8e-07 gb|ABK23159.1| unknown [Picea sitchensis] 58 9e-07 gb|ONK72870.1| uncharacterized protein A4U43_C04F24260, partial ... 59 1e-06 ref|XP_017700363.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 57 2e-06 ref|XP_019086726.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 59 2e-06 gb|PON98951.1| JAB1/MPN/MOV34 metalloenzyme domain containing pr... 59 3e-06 gb|PON35912.1| JAB1/MPN/MOV34 metalloenzyme domain containing pr... 59 3e-06 gb|PNX98427.1| amsh-like ubiquitin thioesterase 1-like protein, ... 60 3e-06 ref|XP_023766798.1| AMSH-like ubiquitin thioesterase 3 isoform X... 60 4e-06 ref|XP_023766797.1| AMSH-like ubiquitin thioesterase 3 isoform X... 60 4e-06 dbj|GAV90677.1| JAB domain-containing protein [Cephalotus follic... 60 4e-06 ref|XP_010549118.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 60 4e-06 ref|XP_006855309.1| AMSH-like ubiquitin thioesterase 3 [Amborell... 60 4e-06 ref|XP_012840488.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 59 4e-06 ref|XP_016709741.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 60 4e-06 >ref|XP_008780764.1| PREDICTED: AMSH-like ubiquitin thioesterase 2 [Phoenix dactylifera] Length = 110 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSS+DLHTHYSYQ+MLPE Sbjct: 15 THPTQSCFMSSIDLHTHYSYQIMLPE 40 >gb|PKA54944.1| AMSH-like ubiquitin thioesterase 3 [Apostasia shenzhenica] Length = 124 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQ+MLPE Sbjct: 27 THPTQSCFMSSVDLHTHYSYQIMLPE 52 >gb|PKI43847.1| hypothetical protein CRG98_035681 [Punica granatum] Length = 169 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSS+DLHTHYSYQ+MLPE Sbjct: 74 THPTQSCFMSSIDLHTHYSYQIMLPE 99 >ref|XP_008351920.2| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Malus domestica] Length = 169 Score = 59.7 bits (143), Expect = 5e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSS+DLHTHYSYQ+MLPE Sbjct: 74 THPTQSCFMSSIDLHTHYSYQIMLPE 99 >gb|EPS59442.1| hypothetical protein M569_15365, partial [Genlisea aurea] Length = 142 Score = 58.9 bits (141), Expect = 6e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQ+CFMSSVDLHTHYSYQ+MLPE Sbjct: 47 THPTQTCFMSSVDLHTHYSYQIMLPE 72 >ref|XP_002988433.1| hypothetical protein SELMODRAFT_128074, partial [Selaginella moellendorffii] gb|EFJ10523.1| hypothetical protein SELMODRAFT_128074, partial [Selaginella moellendorffii] Length = 172 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVD+HTHYSYQVMLPE Sbjct: 77 THPTQSCFMSSVDVHTHYSYQVMLPE 102 >gb|ABK23159.1| unknown [Picea sitchensis] Length = 118 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THP+Q+CFMSSVDLHTHYSYQVMLPE Sbjct: 23 THPSQNCFMSSVDLHTHYSYQVMLPE 48 >gb|ONK72870.1| uncharacterized protein A4U43_C04F24260, partial [Asparagus officinalis] Length = 165 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/26 (88%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSS+D+HTHYSYQ+MLPE Sbjct: 26 THPTQSCFMSSIDVHTHYSYQIMLPE 51 >ref|XP_017700363.1| PREDICTED: AMSH-like ubiquitin thioesterase 2 [Phoenix dactylifera] Length = 136 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -2 Query: 103 TLNYDLQVTHPTQSCFMSSVDLHTHYSYQVMLPE 2 TL+ L +THP+Q+CF+SS+DLHT YSYQVMLPE Sbjct: 29 TLHAILPITHPSQTCFLSSIDLHTQYSYQVMLPE 62 >ref|XP_019086726.1| PREDICTED: AMSH-like ubiquitin thioesterase 3 isoform X2 [Camelina sativa] Length = 223 Score = 58.9 bits (141), Expect = 2e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQ+CFMSSVDLHTHYSYQ+MLPE Sbjct: 128 THPTQTCFMSSVDLHTHYSYQIMLPE 153 >gb|PON98951.1| JAB1/MPN/MOV34 metalloenzyme domain containing protein [Trema orientalis] Length = 271 Score = 59.3 bits (142), Expect = 3e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQVM+PE Sbjct: 176 THPTQSCFMSSVDLHTHYSYQVMVPE 201 >gb|PON35912.1| JAB1/MPN/MOV34 metalloenzyme domain containing protein [Parasponia andersonii] Length = 271 Score = 59.3 bits (142), Expect = 3e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQVM+PE Sbjct: 176 THPTQSCFMSSVDLHTHYSYQVMVPE 201 >gb|PNX98427.1| amsh-like ubiquitin thioesterase 1-like protein, partial [Trifolium pratense] Length = 334 Score = 59.7 bits (143), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSS+DLHTHYSYQ+MLPE Sbjct: 239 THPTQSCFMSSIDLHTHYSYQIMLPE 264 >ref|XP_023766798.1| AMSH-like ubiquitin thioesterase 3 isoform X2 [Lactuca sativa] Length = 488 Score = 60.1 bits (144), Expect = 4e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQ+MLPE Sbjct: 393 THPTQSCFMSSVDLHTHYSYQIMLPE 418 >ref|XP_023766797.1| AMSH-like ubiquitin thioesterase 3 isoform X1 [Lactuca sativa] gb|PLY83215.1| hypothetical protein LSAT_1X44040 [Lactuca sativa] Length = 510 Score = 60.1 bits (144), Expect = 4e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQ+MLPE Sbjct: 415 THPTQSCFMSSVDLHTHYSYQIMLPE 440 >dbj|GAV90677.1| JAB domain-containing protein [Cephalotus follicularis] Length = 510 Score = 60.1 bits (144), Expect = 4e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQ+MLPE Sbjct: 415 THPTQSCFMSSVDLHTHYSYQIMLPE 440 >ref|XP_010549118.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 [Tarenaya hassleriana] Length = 517 Score = 60.1 bits (144), Expect = 4e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQ+MLPE Sbjct: 422 THPTQSCFMSSVDLHTHYSYQIMLPE 447 >ref|XP_006855309.1| AMSH-like ubiquitin thioesterase 3 [Amborella trichopoda] gb|ERN16776.1| hypothetical protein AMTR_s00057p00067120 [Amborella trichopoda] Length = 521 Score = 60.1 bits (144), Expect = 4e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSSVDLHTHYSYQ+MLPE Sbjct: 426 THPTQSCFMSSVDLHTHYSYQIMLPE 451 >ref|XP_012840488.1| PREDICTED: AMSH-like ubiquitin thioesterase 3 isoform X2 [Erythranthe guttata] gb|EYU45512.1| hypothetical protein MIMGU_mgv1a011820mg [Erythranthe guttata] Length = 269 Score = 58.9 bits (141), Expect = 4e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQ+CFMSS+DLHTHYSYQVMLPE Sbjct: 174 THPTQTCFMSSIDLHTHYSYQVMLPE 199 >ref|XP_016709741.1| PREDICTED: AMSH-like ubiquitin thioesterase 1 isoform X5 [Gossypium hirsutum] Length = 400 Score = 59.7 bits (143), Expect = 4e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -2 Query: 79 THPTQSCFMSSVDLHTHYSYQVMLPE 2 THPTQSCFMSS+DLHTHYSYQ+MLPE Sbjct: 305 THPTQSCFMSSIDLHTHYSYQIMLPE 330